GapMind for catabolism of small carbon sources

 

Aligments for a candidate for astD in Paraburkholderia bryophila 376MFSha3.1

Align Succinylglutamic semialdehyde dehydrogenase (EC 1.2.1.71) (characterized)
to candidate H281DRAFT_03178 H281DRAFT_03178 succinate semialdehyde dehydrogenase

Query= reanno::pseudo13_GW456_L13:PfGW456L13_1974
         (488 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_03178 H281DRAFT_03178
           succinate semialdehyde dehydrogenase
          Length = 486

 Score =  202 bits (514), Expect = 2e-56
 Identities = 153/463 (33%), Positives = 220/463 (47%), Gaps = 12/463 (2%)

Query: 5   YIAGEWL-AGGGEAFESLNPVTQQVLWSGVGATAGQVESAVQAARQAFPDWARRTLEERI 63
           Y+AGEW  A  G  FE +NP T +V+ +       +   A+ AA  A+P W   T ++R 
Sbjct: 17  YLAGEWQGADDGSTFEVVNPATGEVVATVPRMGTAETRRAIDAANAAWPAWRASTAKQRA 76

Query: 64  SVLEAFAAALKNHADELAHTIGEETGKPLWEAATEVTSMVNKIAISVQSYRERTGEK-SG 122
            +L  +   +  +AD+LA  +  E GKPL EA  E+    + +    +  +   G+    
Sbjct: 77  VILRKWHDLMLENADDLALILTTEQGKPLAEAKGEIQYAASFLEWFAEEGKRLNGDTIPT 136

Query: 123 PLGDATAVLRHKPHGVVAVFGPYNFPGHLPNGHIVPALLAGNSVLFKPSELTPKVAELTV 182
           P  D   V+  +P GV A   P+NFP  +    + PAL AG  ++ KP+E TP  A    
Sbjct: 137 PANDKRIVVTKEPVGVCAAITPWNFPAAMITRKVGPALAAGCPIIVKPAEATPLSALALA 196

Query: 183 KCWIEAGLPAGVLNLLQG-ARETGIALAANPGIDGLFFTGSSRTGNHLHQQFAGRPDKIL 241
                AG+P GV N++ G  +  G  +  NP +  L FTGS+  G  L  Q A    K+ 
Sbjct: 197 VLAERAGVPRGVFNVVTGEPKAIGAEMTGNPIVRKLSFTGSTPVGRLLMAQCAPTVKKV- 255

Query: 242 ALEMGGNNPLVVDQVADLDAAVYTIIQSAFISAGQRCTCARRLLVPQGAWGDSLLARLVA 301
           +LE+GGN P +V   ADLDAAV   I S + ++GQ C C  R  V    + D+  A+L A
Sbjct: 256 SLELGGNAPFIVFDDADLDAAVAGAIASKYRNSGQTCVCTNRFYVHDKVY-DAFAAKLRA 314

Query: 302 VSSTLSVGAFDQQPAPFMGSVVSLGAAKALMDAQEHLLANGAVALLEMTQPQAQSALLTP 361
               L+VG    +     G +++  A   +    E  LA GA  +    +         P
Sbjct: 315 AVEQLTVGR-GTEAGVTQGPLINEAAVLKVESHIEDALAKGARVVTGGKRHALGHGFFEP 373

Query: 362 GIL-DVSAVADRPDEELFGPLLQVIRYADFEAAIAEANDTAYGLAAGLLSDSEARYQQFW 420
            IL DV+       +E FGPL  + R++  E  IA ANDT +GLA+   S    R  +  
Sbjct: 374 TILADVTPDMKVARDETFGPLAPLFRFSSDEEVIALANDTEFGLASYFYSRDIGRVWRVA 433

Query: 421 LESRAGIVNWNKQLTGAASS--APFGGVGASGNHRASAYYAAD 461
                G+V  N   TG  S+  APFGGV  SG  R  ++Y  D
Sbjct: 434 EALEYGMVGIN---TGLISNEVAPFGGVKQSGLGREGSHYGID 473


Lambda     K      H
   0.316    0.132    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 514
Number of extensions: 26
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 488
Length of database: 486
Length adjustment: 34
Effective length of query: 454
Effective length of database: 452
Effective search space:   205208
Effective search space used:   205208
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory