Align Gamma aminobutyrate transaminase 3, chloroplastic; Gamma-aminobutyrate transaminase isozyme 3; LeGABA-TP3; SlGABA-T3; EC 2.6.1.96 (characterized)
to candidate H281DRAFT_05493 H281DRAFT_05493 4-aminobutyrate---pyruvate transaminase
Query= SwissProt::Q84P52 (520 letters) >FitnessBrowser__Burk376:H281DRAFT_05493 Length = 462 Score = 404 bits (1038), Expect = e-117 Identities = 199/420 (47%), Positives = 278/420 (66%), Gaps = 1/420 (0%) Query: 84 PLVIQKSEGSYVYDVNGKKYLDALAGLWCTSLGGNEPRLVAAATKQLNELAFYHSFWNRS 143 PLV+ + +G VYD GK+Y+++++GLWC +LG ++ RL AAAT+QL L +YH+F +R Sbjct: 34 PLVMCRGDGICVYDETGKEYIESMSGLWCAALGFSDRRLAAAATRQLETLPYYHTFNHRV 93 Query: 144 TKPSLDLAKELLDLFTANKMAKAFFTNSGSEANDTQVKLVWYYNNALGRPDKKKFIARTK 203 LA+ + + K FF +SGSEANDT K+ W Y+ ALG+P+++K IA K Sbjct: 94 PDVVARLAERVAAIVPLED-PKIFFASSGSEANDTMTKIAWSYHRALGKPERRKMIAHKK 152 Query: 204 SYHGSTLISASLSGLPALHQQFDLPAPFVLHTDCPHFWRFHQPGETEEEFSTRLANNLEN 263 +HGST++ ASLSGLP +H F LP +LH +CPHF+R + ETE EF RL LE Sbjct: 153 GFHGSTVMGASLSGLPHMHAAFGLPVEGILHVECPHFYRNGRSNETEAEFVARLVAELEA 212 Query: 264 LILKEGPETIAAFIAEPVMGAGGVIPPPATYFEKVQAILKKYDILFIADEVICGFGRLGT 323 LI +EG TIAAFI+EP++GAGGVI PPA YF VQ +L+K+ IL ++DE+ICGFGR G Sbjct: 213 LIAREGAGTIAAFISEPILGAGGVIVPPAGYFPAVQKVLRKHGILMLSDEIICGFGRTGD 272 Query: 324 MFGCEKYNIKPDLVSVAKALSSGYMPIGAVLVSPEVSDVIYSQSNKLGTFSHGFTYSGHP 383 FG + PD++S AK LSSGY+PI AV++S E+ + S+S + G F HGFTYSGHP Sbjct: 273 WFGAQGAGFVPDMMSCAKTLSSGYVPISAVVISGEIYSALQSESARSGPFGHGFTYSGHP 332 Query: 384 VSCAVALETLKIYKERNIIEQVNRISPKFQEGLKAFSDSPIIGEIRGTGLLHGTEFTDNK 443 V+ AVALE + IY+E N E+ + + L + + P++GEIRG GL+ G E +K Sbjct: 333 VAAAVALEAVTIYQEMNAPERTQELGAYLHDRLASLAGHPLVGEIRGRGLIAGIELVSDK 392 Query: 444 SPNDPFPPEWGIGAYFGARCEKHGVLVRVAGDNIMMSPPYILSLEEIDELIIKYGKALKD 503 PF E +GA AR HG+++R GD I +SPP+I++ +EID ++ K +AL + Sbjct: 393 DTRAPFRSEAHVGATVEARARAHGLILRNMGDVIALSPPFIVTRDEIDLIVQKLTRALDE 452 Lambda K H 0.317 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 626 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 520 Length of database: 462 Length adjustment: 34 Effective length of query: 486 Effective length of database: 428 Effective search space: 208008 Effective search space used: 208008 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory