GapMind for catabolism of small carbon sources

 

Aligments for a candidate for patA in Paraburkholderia bryophila 376MFSha3.1

Align putrescine-pyruvate transaminase (EC 2.6.1.113) (characterized)
to candidate H281DRAFT_01082 H281DRAFT_01082 putrescine aminotransferase

Query= BRENDA::Q9I6J2
         (456 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_01082 H281DRAFT_01082
           putrescine aminotransferase
          Length = 478

 Score =  547 bits (1409), Expect = e-160
 Identities = 259/445 (58%), Positives = 332/445 (74%), Gaps = 3/445 (0%)

Query: 10  TREWQALSRDHHLPPFTDYKQLNEKGARIITKAEGVYIWDSEGNKILDAMAGLWCVNVGY 69
           T E++AL   HH+ PF+D  +LN  G+R+I +A GVY+WDSEGNKI+D MAGLWCVNVGY
Sbjct: 28  TAEYRALDAAHHIHPFSDMGELNRSGSRVIVRAHGVYLWDSEGNKIIDGMAGLWCVNVGY 87

Query: 70  GREELVQAATRQMRELPFYNLFFQTAHPPVVELAKAIADVAPEGMNHVFFTGSGSEANDT 129
           GR+EL  AA RQM ELP+YN FF+T HPPV+EL+  +A++APE  NH F+  SGSEANDT
Sbjct: 88  GRKELANAAYRQMEELPYYNTFFKTTHPPVIELSALLAELAPEPFNHFFYCNSGSEANDT 147

Query: 130 VLRMVRHYWATKGQPQKKVVIGRWNGYHGSTVAGVSLGGMKALHEQGDFPIPGIVHIAQP 189
           VLR+V  YW T+G+  KKVVI R NGYHGST+AG +LGGM  +HEQ    +  IVHI QP
Sbjct: 148 VLRIVHRYWTTQGKHSKKVVISRRNGYHGSTIAGGTLGGMGYMHEQMPSKVENIVHIDQP 207

Query: 190 YWYGE-GGDMSPDEFGVWAAEQLEKKILEVGEENVAAFIAEPIQGAGGVIVPPDTYWPKI 248
           Y++ E     +P+EF +  A+QLE KILE+G  NVAAFI EP QGAGGVI P  TYWP+I
Sbjct: 208 YFFAEANSSQTPEEFALARAQQLEMKILEIGAHNVAAFIGEPFQGAGGVIFPASTYWPEI 267

Query: 249 REILAKYDILFIADEVICGFGRTGEWFGSQYYGNAPDLMPIAKGLTSGYIPMGGVVVRDE 308
             I  KYD+L +ADEVI GFGRTGEWF  Q++G  PDL+ +AKGLTSGY+PMG V + D 
Sbjct: 268 ERICRKYDVLLVADEVIGGFGRTGEWFAHQHFGFQPDLITMAKGLTSGYVPMGAVGLNDR 327

Query: 309 IVEVLNQGGEFYHGFTYSGHPVAAAVALENIRILREEKIIEKVKAETAPYLQKRWQE-LA 367
           I + + + GEF HG TYSGHPVAAAVA+ N+++LR+EKI+E+VK +T PY QK+ ++  A
Sbjct: 328 IAKAIIENGEFNHGLTYSGHPVAAAVAVANLKLLRDEKIVERVKTDTGPYFQKKLRDTFA 387

Query: 368 DHPLVGEARGVGMVAALELVKNKKTRERFTDKG-VGMLCREHCFRNGLIMRAVGDTMIIS 426
            HP+VGE  G G+VA L+L +   +R+RF + G VG +CR+ CF   LIMRA GD M++S
Sbjct: 388 RHPIVGEIAGAGLVAGLQLAEEPASRKRFANGGDVGGVCRDFCFNGNLIMRASGDRMLLS 447

Query: 427 PPLVIDPSQIDELITLARKCLDQTA 451
           PPLVI   +ID+L++ A+  +D TA
Sbjct: 448 PPLVISKQEIDDLVSKAKNAIDATA 472


Lambda     K      H
   0.320    0.138    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 706
Number of extensions: 35
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 456
Length of database: 478
Length adjustment: 33
Effective length of query: 423
Effective length of database: 445
Effective search space:   188235
Effective search space used:   188235
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory