Align 4-(gamma-glutamylamino)butanal dehydrogenase (EC 1.2.1.99) (characterized)
to candidate H281DRAFT_03016 H281DRAFT_03016 aldehyde dehydrogenase (acceptor)
Query= BRENDA::P23883 (495 letters) >FitnessBrowser__Burk376:H281DRAFT_03016 Length = 483 Score = 388 bits (997), Expect = e-112 Identities = 204/475 (42%), Positives = 296/475 (62%), Gaps = 6/475 (1%) Query: 22 LFINGEYTAAAENETFETVDPVTQAPLAKIARGKSVDIDRAMSAARGVFERGDWSLSSPA 81 L I+G+ E ++P T+ P+A +A+G + D+D A+ AAR + W+ A Sbjct: 12 LLIDGKRLPPGTGEYSVNINPATEEPIAHVAQGSAADVDTAVRAARAALKV--WNGIKAA 69 Query: 82 KRKAVLNKLADLMEAHAEELALLETLDTGKPIRHSLRDDIPGAARAIRWYAEAIDKVYGE 141 +R +L++LA LM A+ +ELA LE+LD GKPI +R D+P A + +YA DK+ G+ Sbjct: 70 ERGRILSRLAGLMRANLDELAALESLDAGKPIAAVMRQDVPAAIDTLEYYAGWCDKINGQ 129 Query: 142 VATTSSHELAMIVREPVGVIAAIVPWNFPLLLTCWKLGPALAAGNSVILKPSEKSPLSAI 201 V L +REPVGV+AAIVPWNFPL++ WK+ PALA G ++I+KP+E +PLSA+ Sbjct: 130 VVPVRPDALTYTLREPVGVVAAIVPWNFPLMIGMWKIAPALACGCTLIVKPAEITPLSAL 189 Query: 202 RLAGLAKEAGLPDGVLNVVTGFGHEAGQALSRHNDIDAIAFTGSTRTGKQLLKDAGDSNM 261 R+ LA EAG+P GVLN+VTG G G AL H +D + FTGS G+ +L+ A N Sbjct: 190 RIGELALEAGVPPGVLNIVTGKGRVVGDALVAHPGVDKVTFTGSPSVGRGILQGAA-GNF 248 Query: 262 KRVWLEAGGKSANIVFADCPDLQQAASATAAGIFYNQGQVCIAGTRLLLEESIADEFLAL 321 KRV LE GGKSAN++F D +L A A A+GIF+N GQVC AG+R+L + DE + Sbjct: 249 KRVTLELGGKSANLIFPDA-NLDNAVRAAASGIFFNTGQVCSAGSRILAHRDVYDEVVER 307 Query: 322 LKQQAQNWQPGHPLDPATTMGTLIDCAHADSVHSFIREGESKGQLLL--DGRNAGLAAAI 379 L +A++ + G P T+MG LI A +V ++ G S+G L+ GR + Sbjct: 308 LAARAKSIKVGDPSSRETSMGPLISAAQMKTVLGYVDAGRSEGASLVTGGGRIGERGFFV 367 Query: 380 GPTIFVDVDPNASLSREEIFGPVLVVTRFTSEEQALQLANDSQYGLGAAVWTRDLSRAHR 439 PT+F +V+ +S+EEIFGPV V RF E A+++AN + Y L A VW+ D+ R HR Sbjct: 368 EPTVFANVEHEMRISQEEIFGPVASVIRFNDEADAIRIANGTLYSLAAGVWSADIGRVHR 427 Query: 440 MSRRLKAGSVFVNNYNDGDMTVPFGGYKQSGNGRDKSLHALEKFTELKTIWISLE 494 ++R L+AG+V++N Y D+ +P+GG SG GR+ A+E FTE K +W++++ Sbjct: 428 VARDLRAGTVWINTYGYTDVRLPWGGSGDSGFGREHGDVAIENFTEPKAVWLAID 482 Lambda K H 0.317 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 626 Number of extensions: 30 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 495 Length of database: 483 Length adjustment: 34 Effective length of query: 461 Effective length of database: 449 Effective search space: 206989 Effective search space used: 206989 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory