Align deoxynucleoside transporter, permease component 2 (characterized)
to candidate H281DRAFT_02330 H281DRAFT_02330 L-arabinose ABC transporter membrane protein
Query= reanno::Burk376:H281DRAFT_01112 (364 letters) >FitnessBrowser__Burk376:H281DRAFT_02330 Length = 334 Score = 140 bits (354), Expect = 4e-38 Identities = 106/341 (31%), Positives = 169/341 (49%), Gaps = 31/341 (9%) Query: 25 MTTPTVVEIAPSVEAPGLRTRLARNPEWFTVALIVVTCLIVGAIN----PRFFQFATLFD 80 M TP+ P+V + GL R AR + + IV+ +I+ A+ P F + Sbjct: 1 MHTPSTDPSTPAVASAGLSARAARTWDLINKSGIVMVFIILFAVLSFTVPDFLSSRNIQG 60 Query: 81 LLHSATTMSLFALGTLVVLASGGIDVS------FTAIAALTMYGITKAVFAWWPDAPFAL 134 LL S T + ++ + VLA G +D+S F + A T+ +T +V L Sbjct: 61 LLLSVTLIGSISVTMMFVLALGEVDLSVASIVAFAGVVASTLITVTHSVL---------L 111 Query: 135 ILVTGALGGVVLGMVNGLLVHRLKAPSLIVTIGTQYLYRGL-LLTFIGTTFFMNIPHSMD 193 + G L G +G+VNG+LV R K SLIVT+ + RGL +T G + S + Sbjct: 112 GVAAGVLAGGAVGLVNGVLVARYKINSLIVTLAMMEVVRGLAFITSSGDAVMI----SEE 167 Query: 194 RFGRIPLFFYHTADGLRAVLPVSVLALVAAAVVTWWLLNRTMMGRAVYAMGGSLAIAERL 253 RF + G + + + + VV +LL +T+ G+ V A+GG+ A Sbjct: 168 RF-------FDLGGGSFLGISYPIWSNIIGFVVFGFLLKKTVFGKNVLAVGGNSEAALLA 220 Query: 254 GYNLRAIHLFVFGYTGMLAGIAGILHVSNNRLANPFDLVGSELDVIAAVILGGARITGGT 313 G + I + VF G++ G AG++ S L +P VG EL VI+A +LGG +TGG Sbjct: 221 GLPVTRIKITVFVLQGLVTGFAGVMLASRMSLGDPKTSVGLELGVISACVLGGVSLTGGV 280 Query: 314 GTVVGTLLGVVLVTLIKSVLILVGVPSTWQKVIIGAFILLA 354 T+ G L+GV+++ ++ + L+ VP+ +Q +I G +LLA Sbjct: 281 ATISGVLVGVLIMGSVQDAMSLMNVPTFYQYLIRGGILLLA 321 Lambda K H 0.328 0.141 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 292 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 334 Length adjustment: 29 Effective length of query: 335 Effective length of database: 305 Effective search space: 102175 Effective search space used: 102175 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory