GapMind for catabolism of small carbon sources

 

Aligments for a candidate for acs in Paraburkholderia bryophila 376MFSha3.1

Align 4-hydroxybutyrate-CoA ligase (EC 6.2.1.40) (characterized)
to candidate H281DRAFT_01203 H281DRAFT_01203 acetyl-CoA synthetase

Query= BRENDA::A4YDT1
         (564 letters)



>lcl|FitnessBrowser__Burk376:H281DRAFT_01203 H281DRAFT_01203
           acetyl-CoA synthetase
          Length = 567

 Score =  360 bits (923), Expect = e-103
 Identities = 215/537 (40%), Positives = 306/537 (56%), Gaps = 20/537 (3%)

Query: 35  LRRFNWVRDVFEDIHVKERGSKTALIWRDINTGEEAKLSYHELSLMSNRVLSTLRKHGLK 94
           L +FNW  D F+ I        TAL   D    E  +LSY ++S  S R+ + LR  G+K
Sbjct: 33  LEQFNWALDYFDVI--ARDNDNTALWIVDDPASEGLRLSYAQMSERSARMANFLRSVGVK 90

Query: 95  KGDVVYLMTKVHPMHWAVFLAVIKGGFVMVPSATNLTVAEMKYRFSDLKPSAIISDSLRA 154
           +GD V LM       W V LA +K G +++P+ T L+  +++ R      + ++ DS   
Sbjct: 91  RGDRVLLMLPNRVELWDVMLAAMKLGAIVLPATTQLSADDVRDRVQIGGANFVVVDSAEL 150

Query: 155 SVMEEALGSLKVEKFLIDGKRETWNSLE---DESSNAEPED-TRGEDVIINYFTSGTTGM 210
           S  +     + + +  +   R  W  L    D S    P+  TR  D ++ YFTSGTT  
Sbjct: 151 SKFDSL--DVPLTRLSVGTPRAGWTDLAAAYDASPQFTPDGVTRAADPLLLYFTSGTTSK 208

Query: 211 PKRVIHTAVSYPVGSITTASIVGVRESDLHLNLSATGWAKFAWSSFFSPLLVGATVVGIN 270
           PK V HT  SYPVG ++T   +G++  D+H N+S+ GWAK AWS FF+P    A V   N
Sbjct: 209 PKLVEHTHQSYPVGHLSTMYWIGLQPGDIHWNISSPGWAKHAWSCFFAPWNAQACVFVFN 268

Query: 271 YEGKLDTRRYLGEVENLGVTSFCAPPTAWRQFITLDLDQFRFERLRSVVSAGEPLNPEVI 330
           +  +   +  L  +    VT+ CAPPT WR  +   L  +   +LR +V AGEPLNPE+I
Sbjct: 269 F-ARFVPKDTLDVLVRFNVTTVCAPPTVWRMLVQEHLTDYPV-KLREIVGAGEPLNPEII 326

Query: 331 KIWKDKFNLTIRDFYGQTETTAMVGNFPFLKVKPGSMGKPHPLYDIRLLDDEGKEITKPY 390
           +  K  + +TIRD +GQTETT  +GN P   V  GSMG+P P Y I LLD + + +T+  
Sbjct: 327 ERVKHAWGITIRDGFGQTETTCQIGNSPGQPVVAGSMGRPLPGYRIELLDADDQPVTE-- 384

Query: 391 EVGHITVKLNP----RPIGLFLGYSD-EKKNMESFREGYYYTGDKAYFDEEGYFYFVGRG 445
             G I + + P    RP+GL  GY++ E+   ++ R G+Y T D A   E+GY+ +VGR 
Sbjct: 385 --GEIALPIGPDGKQRPLGLMTGYANSEQATAQAMRNGFYRTSDVALRREDGYYVYVGRA 442

Query: 446 DDVIKTSDYRVGPFEVESALLEHPAVAEAAVVGVPDTVRWQLVKAYIVLKKGYMPSKELA 505
           DDV K+SDYR+ PFE+ES L+EH A+ EAAVV   D +R  + KA++ ++ GY    ELA
Sbjct: 443 DDVFKSSDYRLSPFELESVLIEHEAIGEAAVVPSADALRLSVPKAFVTVRHGYQAGPELA 502

Query: 506 EEIREKMKTLLSPYKVPRIIEFVDELPKTISGKIRRVELRKREEEKRKKGEVGQNEY 562
             +    +  L+PYK  R ++F  ELPKTISGKIRRVELR+RE E++ +     +EY
Sbjct: 503 RAVFAFSREKLAPYKRIRRLQF-SELPKTISGKIRRVELRRREMERQAEPARLPDEY 558


Lambda     K      H
   0.318    0.137    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 758
Number of extensions: 38
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 564
Length of database: 567
Length adjustment: 36
Effective length of query: 528
Effective length of database: 531
Effective search space:   280368
Effective search space used:   280368
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory