Align Acetaldehyde dehydrogenase; Acetaldehyde dehydrogenase [acetylating]; EC 1.2.1.10 (characterized)
to candidate H281DRAFT_01665 H281DRAFT_01665 acetaldehyde dehydrogenase
Query= SwissProt::Q52060 (312 letters) >FitnessBrowser__Burk376:H281DRAFT_01665 Length = 320 Score = 432 bits (1110), Expect = e-126 Identities = 221/312 (70%), Positives = 261/312 (83%), Gaps = 3/312 (0%) Query: 1 MNQKLKVAIIGSGNIGTDLMIKVLRNAKYLEMGAMVGIDAASDGLARAQRMGVTTTYAGV 60 MN+K+KVAIIG GNIGTDLMIKV+RN+++LEM AMVG+D SDGLARA+RMGV TT G+ Sbjct: 1 MNEKVKVAIIGPGNIGTDLMIKVMRNSQHLEMAAMVGVDPKSDGLARAERMGVATTAEGI 60 Query: 61 EGLIKLPEFADIDFVFDATSASAHVQNEALLRQAKPGIRLIDLTPAAIGPYCVPVVNLEE 120 +GL+KL F +ID VFDATSASAH + +L+ K G+++IDLTPAA+GPY +P +NLE Sbjct: 61 DGLLKLDVFKNIDIVFDATSASAHKHHNDVLQ--KHGVQVIDLTPAAVGPYVIPAINLEA 118 Query: 121 HLGKLNVNMVTCGGQATIPMVAAVSRVAKVHYAEIVASISSKSAGPGTRANIDEFTETTS 180 N+NMVTCGGQATIP+VAAVSRVAKVHYAEIVASISS+SAGPGTRANIDEFTETT Sbjct: 119 ENAS-NMNMVTCGGQATIPIVAAVSRVAKVHYAEIVASISSRSAGPGTRANIDEFTETTR 177 Query: 181 KAIEVIGGAAKGKAIIIMNPAEPPLIMRDTVYVLSAAADQAAVAASVAEMVQAVQAYVPG 240 AIE +GGA +GKAII++NPAEPPLIMRDTV+VLS D AV SVA+M+ +VQAYVPG Sbjct: 178 SAIETLGGATRGKAIIVLNPAEPPLIMRDTVFVLSDLVDVNAVEDSVAQMITSVQAYVPG 237 Query: 241 YRLKQQVQFDVIPESAPLNIPGLGRFSGLKTSVFLEVEGAAHYLPAYAGNLDIMTSAALA 300 YRLKQ++QFD++ PLN+PGLG GLKTSVFLEVEGAAHYLP+YAGNLDIMTSAALA Sbjct: 238 YRLKQKIQFDIVSPEKPLNVPGLGVKHGLKTSVFLEVEGAAHYLPSYAGNLDIMTSAALA 297 Query: 301 TAERMAQSMLNA 312 + MA+ L A Sbjct: 298 CGDMMARRRLAA 309 Lambda K H 0.317 0.132 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 339 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 312 Length of database: 320 Length adjustment: 27 Effective length of query: 285 Effective length of database: 293 Effective search space: 83505 Effective search space used: 83505 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate H281DRAFT_01665 H281DRAFT_01665 (acetaldehyde dehydrogenase)
to HMM TIGR03215 (acetaldehyde dehydrogenase (acetylating) (EC 1.2.1.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03215.hmm # target sequence database: /tmp/gapView.4842.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03215 [M=285] Accession: TIGR03215 Description: ac_ald_DH_ac: acetaldehyde dehydrogenase (acetylating) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-146 471.9 5.7 4e-146 471.7 5.7 1.0 1 lcl|FitnessBrowser__Burk376:H281DRAFT_01665 H281DRAFT_01665 acetaldehyde deh Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Burk376:H281DRAFT_01665 H281DRAFT_01665 acetaldehyde dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 471.7 5.7 4e-146 4e-146 1 284 [. 4 307 .. 4 308 .. 0.99 Alignments for each domain: == domain 1 score: 471.7 bits; conditional E-value: 4e-146 TIGR03215 1 kvkvaiiGsGnigtdllikllr.sevlelallvGidpesdGlararelgvetsaeGvdalleee.. 63 kvkvaiiG+Gnigtdl+ik++r s++le+a++vG+dp+sdGlara+++gv+t+aeG+d+ll+ + lcl|FitnessBrowser__Burk376:H281DRAFT_01665 4 KVKVAIIGPGNIGTDLMIKVMRnSQHLEMAAMVGVDPKSDGLARAERMGVATTAEGIDGLLKLDvf 69 79********************9***************************************9889 PP TIGR03215 64 .didivfdatsakahaenaklleelgkividltPaavGpyvvPavnleevldaknvnlvtCgGqat 128 +idivfdatsa+ah++++++l+++g++vidltPaavGpyv+Pa+nle+ ++a+n+n+vtCgGqat lcl|FitnessBrowser__Burk376:H281DRAFT_01665 70 kNIDIVFDATSASAHKHHNDVLQKHGVQVIDLTPAAVGPYVIPAINLEA-ENASNMNMVTCGGQAT 134 9**********************************************98.8899************ PP TIGR03215 129 iPivaavsrvakvkyaeivasiasksaGpgtranideftettskaleqvgGakkgkaiiilnPaeP 194 iPivaavsrvakv+yaeivasi+s+saGpgtranideftett+ a+e++gGa++gkaii+lnPaeP lcl|FitnessBrowser__Burk376:H281DRAFT_01665 135 IPIVAAVSRVAKVHYAEIVASISSRSAGPGTRANIDEFTETTRSAIETLGGATRGKAIIVLNPAEP 200 ****************************************************************** PP TIGR03215 195 pllmrdtvyalveeadeeaieasveemveevqkyvpGyrlkqevvld.................ge 243 pl+mrdtv++l++ +d +a+e+sv++m+++vq+yvpGyrlkq++++d g lcl|FitnessBrowser__Burk376:H281DRAFT_01665 201 PLIMRDTVFVLSDLVDVNAVEDSVAQMITSVQAYVPGYRLKQKIQFDivspekplnvpglgvkhGL 266 ****************************************************************** PP TIGR03215 244 kvsvlleveGagdylPkyaGnldiltaaalavaeklaeell 284 k+sv+leveGa++ylP+yaGnldi+t+aala+++++a+++l lcl|FitnessBrowser__Burk376:H281DRAFT_01665 267 KTSVFLEVEGAAHYLPSYAGNLDIMTSAALACGDMMARRRL 307 *************************************9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (285 nodes) Target sequences: 1 (320 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.01 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory