Align 2-deoxy-D-ribonate transporter 1 (characterized)
to candidate H281DRAFT_03814 H281DRAFT_03814 Sugar phosphate permease
Query= reanno::WCS417:GFF1429 (438 letters) >FitnessBrowser__Burk376:H281DRAFT_03814 Length = 443 Score = 323 bits (829), Expect = 5e-93 Identities = 168/404 (41%), Positives = 236/404 (58%), Gaps = 4/404 (0%) Query: 21 LMPLLIIAYILSFLDRTNIALAKHHLDVDLGISAAAYGLGAGLFFLTYALSEIPSNLIMH 80 ++PL +I +I +++DR NI H+ DLGI AAAYGLG+GLFF+ YAL E+PSN++M Sbjct: 23 VLPLFLIMFIANYIDRVNIGFVNTHMKTDLGIGAAAYGLGSGLFFIGYALFEVPSNVLMQ 82 Query: 81 KVGARFWIARIMVTWGLISAAMAFVQGETSFYVLRLLLGIAEAGLFPGVMLYLTYWFNRE 140 K GAR W+ RIM TWG+++AAMAFV ETSFY+LR LLG+AEAG FPGV+ Y T W ++ Sbjct: 83 KYGARAWLTRIMGTWGVVAAAMAFVSNETSFYMLRFLLGVAEAGFFPGVVFYFTQWLPQK 142 Query: 141 QRARATGYFLLGVCFANIIGGPVGAALMRMDGMLGWHGWQWMFMLEGLPAVAFAWVVWRK 200 +R +A FL G A+++ GP+ +L+ + G LG HGWQWMF++EG ++ V W Sbjct: 143 ERGKAVAIFLSGSAIASVVSGPITGSLLSIRG-LGLHGWQWMFLIEGGFSIVLCAVSWMF 201 Query: 201 LPDRPSKAPWLSAEEARGIEQRIAQETEEGAGEGGHSL---KNWLTPQILLAIFVYFCHQ 257 L R A WL+AEE +E IA E E GG L K PQI+L +YF Q Sbjct: 202 LKSRIRDASWLTAEEQGVLESTIAAEQAERVAHGGAHLPAVKLLKDPQIVLFCLLYFAIQ 261 Query: 258 ITIYTVIFFLPSIISKYGELSTMSVGLLTSLPWIAAALGALLIPRFATTPGRCRRLLVTG 317 +TIY F+LP+II K G LS VG+L ++PW+ A + + + L Sbjct: 262 LTIYAATFWLPTIIRKIGGLSDFEVGMLNAIPWLIAMVAMYCFALLSAKWRFQQAWLAVA 321 Query: 318 LLTMALGLGIASVSGPVFSLLGFCLSAVMFFVVQSIIFLYPASRLKGVALAGGLGFVNAC 377 L+ A GL ++ P+ S + C SA+ F S+ + P L A + +N+ Sbjct: 322 LVIAACGLFASTSGNPLLSFVAICFSAIGFKAAASLFWPIPQGYLDARVAAAVIALINSI 381 Query: 378 GLLGGFVGPSVMGVIEQSTGNAMNGLKVIALVLVVAALAALRLR 421 G LGGF P+ G ++Q TG+ GL + + ++AA AA R Sbjct: 382 GNLGGFFAPATFGYLQQHTGSITGGLYGLGVASLIAAAAAFLTR 425 Lambda K H 0.327 0.141 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 562 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 438 Length of database: 443 Length adjustment: 32 Effective length of query: 406 Effective length of database: 411 Effective search space: 166866 Effective search space used: 166866 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory