Align Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 (characterized)
to candidate H281DRAFT_03306 H281DRAFT_03306 Cytochrome c, mono- and diheme variants
Query= SwissProt::P0A388 (468 letters) >FitnessBrowser__Burk376:H281DRAFT_03306 Length = 434 Score = 365 bits (937), Expect = e-105 Identities = 197/435 (45%), Positives = 264/435 (60%), Gaps = 15/435 (3%) Query: 1 MINRLKVTFSAAAFSLLAGTALAQTPD-------ADSALVQKGAYVARLGDCVACHTALH 53 M+ R K+ A L A T T + A +ALV +G Y+A+ DC CHTA+ Sbjct: 1 MMRRFKLIVLAGTAMLGAFTTPCVTAEPAGASDPALAALVARGEYLAKASDCAGCHTAVG 60 Query: 54 GQSYAGGLEIKSPIGTIYSTNITPDPTYGIGRYTFAEFDEAVRHGIRKDGSTLYPAMPYP 113 GQ+Y GGL + SP GTI S+NITPD YGIG Y++ +F +VR G+ LYPAMPY Sbjct: 61 GQAYGGGLGLTSPFGTIMSSNITPDRRYGIGAYSYEDFARSVREGVSPGNKRLYPAMPYA 120 Query: 114 SFSRMTKEDMQALYAYFMHGVKPVAQPDKQPDISWPLSMRWPLGIWRMMFSPSPKDFTPA 173 SFS+M+ +DM+ALYAYFMHGVKP +P +++P + RW L W++ F+P+ + + P Sbjct: 121 SFSKMSDDDMRALYAYFMHGVKPAPEPAPPTKLAFPFNQRWVLYFWQLAFAPT-EPYRPK 179 Query: 174 PGTDPEIARGDYLVTGPGHCGACHTPRGFAMQEKALDAAGGPDFLSGGAPIDNWVAPSLR 233 G D + RG +LV GPGHCGACHTPRG QE+ D + P +L+GG DNW P+L Sbjct: 180 AGRDAQWNRGAFLVQGPGHCGACHTPRGPGFQERGYDES-SPMYLTGGVN-DNWFGPNLT 237 Query: 234 NDPVVGLGRWSEDDIYTFLKSGRIDHSAVFGGMGDVVAWSTQYFTDDDLHAIAKYLKSLP 293 DP GLGR E D+ FLK+G FG M + V STQY TD+D A+A Y+KSLP Sbjct: 238 GDPGSGLGRIGEKDLAAFLKTGHGAGLVAFGSMVEQVEDSTQYLTDEDALAMAHYVKSLP 297 Query: 294 PVPPSQGNYTYDPSTANMLASGNTASVP---GADTYVKECAICHRNDGGGVARMFPPLAG 350 PS G+Y +GN P GA Y+ CA CH G G+ +FP LAG Sbjct: 298 AQKPS-GSYEPHAQPDLPTRNGNRVDAPQSVGARVYISFCARCHGVQGAGMPNVFPRLAG 356 Query: 351 NPVVVTENPTSLVNVIAHGGVLPPSNWAPSAVAMPGYSKSLSAQQIADVVNFIRTSWGNK 410 NP V+TE+ TSL+ ++ GG P + P AMPG++++L+ Q+A+V+++IRTSWGN Sbjct: 357 NPSVITEDTTSLIRLMVEGGNSPATISGPPRQAMPGFAQTLTNAQMANVLSWIRTSWGND 416 Query: 411 APGTVTAADVTKLRD 425 A VTA D+ LR+ Sbjct: 417 A-RPVTANDIQSLRE 430 Lambda K H 0.317 0.134 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 742 Number of extensions: 40 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 468 Length of database: 434 Length adjustment: 33 Effective length of query: 435 Effective length of database: 401 Effective search space: 174435 Effective search space used: 174435 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory