Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate H281DRAFT_00427 H281DRAFT_00427 monosaccharide ABC transporter membrane protein, CUT2 family
Query= uniprot:D8J112 (347 letters) >FitnessBrowser__Burk376:H281DRAFT_00427 Length = 341 Score = 482 bits (1240), Expect = e-141 Identities = 247/334 (73%), Positives = 287/334 (85%) Query: 12 STTMANTASAQGLRARLFNPAARQKLLAFASLLLMILFFSFASPNFMEVDNLVSILQSTA 71 S+ + GLRAR+F+P A QKLLAFASL+L+++FFSFASP FM++DN++ ILQ+TA Sbjct: 7 SSALTGQRRLTGLRARIFSPTALQKLLAFASLILLLVFFSFASPAFMQMDNILGILQATA 66 Query: 72 VNGVLAIACTYVIITSGIDLSVGTMMTFCAVMAGVVLTNWGMPLPLGIAAAIFFGALSGW 131 VNGVLAIA T+VIIT GIDLSVGT+MTF AV+ GV LT W +P+ LG+ AAI GA+ G Sbjct: 67 VNGVLAIASTFVIITGGIDLSVGTLMTFTAVICGVFLTYWHLPMWLGVIAAIGTGAICGT 126 Query: 132 ISGMVIAKLKVPPFIATLGMMMLLKGLSLVISGTRPIYFNDTEGFSAIAQDSLIGDLIPS 191 ISG + AK+K+PPFIATLGMM+LLKGLSLV+S +PIYF DTE F I+QDSLIG L+PS Sbjct: 127 ISGTLTAKMKIPPFIATLGMMLLLKGLSLVVSADKPIYFTDTENFYMISQDSLIGYLVPS 186 Query: 192 LPIPNAVLILFLVAIGASIILNKTVFGRYTFALGSNEEALRLSGVKVDFWKVAVYTFSGA 251 LPIPNAVLILF +AI +S+ LN+T GRYTFALGSNEEA+RLSGV VD WK+A+Y GA Sbjct: 187 LPIPNAVLILFFLAIVSSVTLNRTALGRYTFALGSNEEAVRLSGVNVDRWKIAIYGLGGA 246 Query: 252 ICGIAGLIIASRLNSAQPALGQGYELDAIAAVVIGGTSLSGGTGTILGTIIGAFIMSVLV 311 ICGIAGL+IASRLNSAQPALGQGYEL+AIAAVVIGGTSLSGG+GTILGTIIGAFIMSVL Sbjct: 247 ICGIAGLLIASRLNSAQPALGQGYELEAIAAVVIGGTSLSGGSGTILGTIIGAFIMSVLT 306 Query: 312 NGLRIMSVAQEWQTVVTGVIIILAVYLDILRRRR 345 NGLRIMSVAQEWQ VVTG+IIILAVY DILRRR+ Sbjct: 307 NGLRIMSVAQEWQIVVTGLIIILAVYADILRRRK 340 Lambda K H 0.326 0.139 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 348 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 341 Length adjustment: 29 Effective length of query: 318 Effective length of database: 312 Effective search space: 99216 Effective search space used: 99216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory