Align L-fucose dehydrogenase (EC 1.1.1.122) (characterized)
to candidate H281DRAFT_03377 H281DRAFT_03377 D-threo-aldose 1-dehydrogenase
Query= reanno::BFirm:BPHYT_RS34225 (346 letters) >FitnessBrowser__Burk376:H281DRAFT_03377 Length = 352 Score = 362 bits (929), Expect = e-105 Identities = 185/329 (56%), Positives = 221/329 (67%), Gaps = 4/329 (1%) Query: 17 RGPLQVTGLGLGTAPLGGLYRDLSDEEAHATIAAAWDAGVRYFDTAPHYGNTKAEHRLGD 76 R L +T LGLG + LGGLY+ +S EA+A + AWDAG+RYFDTAP YG T +E R+G Sbjct: 11 RSGLAMTTLGLGCSQLGGLYKPMSTAEANALLEWAWDAGIRYFDTAPFYGYTLSERRVGQ 70 Query: 77 ALRRYPRADYVLSTKVGRRFVPRTTPFDDKEGWQNPLPFEAIYDYTHDGILRSFEDSQQR 136 +L+ R YVLSTKVGR P T + W PLPF +DYT DGI+RS+EDSQQR Sbjct: 71 SLQMRERERYVLSTKVGRLMRPDDTVLPGDDNWAQPLPFRPRFDYTFDGIMRSYEDSQQR 130 Query: 137 LGIVDIDILLVHDIGRVTHGDNHPHYWRQLTEGGGFRALDALRSSGAIKAVGLGVNEGAA 196 LG+ IDIL VHDIG THGD H YW QLT GGGFRAL LR S A+ A+GLGVNE Sbjct: 131 LGMQTIDILYVHDIGAATHGDAHSRYWEQLTRGGGFRALAELRDSHAVSAIGLGVNEWQV 190 Query: 197 ILDAMAEFDIDCALLAGRYTLLEQTTLDDLLPACEKRGVSILLGGAFNSGILARGVQGDL 256 +D+M E D+D +LAGRYTLLEQ L LL C GV I+ GG FNSG+L G+ Sbjct: 191 AVDSMQEADLDLVMLAGRYTLLEQEALSPLLDQCVSNGVRIVAGGVFNSGVLV----GNG 246 Query: 257 KFNYGEAPPEVIERVARLEAVCRTHGVPLAAAALQFPYAHPTVATVLTGARSADELRENA 316 KFNY +APPEV +VARL C VPLAAAALQFP AHP V + + GARS ++L++N Sbjct: 247 KFNYTDAPPEVARKVARLADACAKFEVPLAAAALQFPLAHPAVVSCVVGARSIEQLQKNI 306 Query: 317 ASFELPIPAALWFALREEGLLDSRAPAPE 345 A E P+P LW AL+ EGL+ AP PE Sbjct: 307 AWLETPVPPELWQALQHEGLIAGSAPVPE 335 Lambda K H 0.320 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 354 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 346 Length of database: 352 Length adjustment: 29 Effective length of query: 317 Effective length of database: 323 Effective search space: 102391 Effective search space used: 102391 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory