Align L-fuculose phosphate aldolase (EC 4.1.2.17) (characterized)
to candidate H281DRAFT_02706 H281DRAFT_02706 L-fuculose-phosphate aldolase
Query= reanno::Koxy:BWI76_RS22915 (215 letters) >FitnessBrowser__Burk376:H281DRAFT_02706 Length = 223 Score = 213 bits (543), Expect = 2e-60 Identities = 113/215 (52%), Positives = 147/215 (68%), Gaps = 9/215 (4%) Query: 2 ERNRLARQIIDTCLEMTRLGLNQGTAGNVSVRYQGGMLITPTGIPYEKLTEAHIVYI--- 58 + L R I++T LEM RLG+NQGT+GNVS R G LITP+G+P +L E IV++ Sbjct: 5 QERALRRGIVETSLEMERLGINQGTSGNVSARLGEGFLITPSGVPARELREEGIVWLPLD 64 Query: 59 ---DAEGQHEQGKLPSSEWRFHLAAYQTRPDAHAVVHNHAVHCTAVSILNRPIPAIHYMI 115 DAE H K PSSEWR H + R + HAVVH H+ TA++I R IPA+HYM+ Sbjct: 65 VDDDAEVLHV--KRPSSEWRIHRDILRARHEMHAVVHTHSTAATAMAIHGRDIPALHYMV 122 Query: 116 AAAGGNSIPCAPYATFGTRELSEHVAVALKNRKATLLQHHGLIACEENLEKALWLAHEVE 175 AAAGG+SI CAPYA FGT+ LS+H AL++R+A LL HHG++A ++L +A+WLAHEVE Sbjct: 123 AAAGGDSIRCAPYALFGTQLLSDHALKALQDRRACLLAHHGVVALGDDLARAVWLAHEVE 182 Query: 176 VLAQLYLSTLAIIDPVPVLDDEAIAVVLEKFKTYG 210 VLA+ YL + P P+L D + VLE+FKTYG Sbjct: 183 VLARQYLLACQ-LGPPPLLSDVQMEEVLERFKTYG 216 Lambda K H 0.320 0.135 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 215 Length of database: 223 Length adjustment: 22 Effective length of query: 193 Effective length of database: 201 Effective search space: 38793 Effective search space used: 38793 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory