Align sodium:C4-dicarboxylate symporter (dctA) (characterized)
to candidate H281DRAFT_03336 H281DRAFT_03336 Na+/H+-dicarboxylate symporter
Query= reanno::pseudo5_N2C3_1:AO356_18980 (450 letters) >FitnessBrowser__Burk376:H281DRAFT_03336 Length = 438 Score = 455 bits (1170), Expect = e-132 Identities = 224/423 (52%), Positives = 312/423 (73%), Gaps = 2/423 (0%) Query: 9 KSLYFQVIVAIAIGILLGHFYPQTGVALKPFGDGFIKLIKMVIAPIIFCTVVSGIGGMQN 68 +SLY QV++ + +G+ +GHF PQ G LKPF D F+ L++M+IAPI+FCT+VSGI + + Sbjct: 8 RSLYVQVLLGMVLGVAVGHFLPQAGALLKPFSDAFVGLVRMMIAPIVFCTIVSGITSLAS 67 Query: 69 MKSVGKTGGYALLYFEIVSTIALLIGLVVVNVVQPGAGMHIDVSTLDTSKIAGFISAGKD 128 K++G+T AL F +++ +AL GLV V++PGAGMHID LDTS +A ++ + Sbjct: 68 GKAIGRTIFKALALFYLLTVVALAFGLVTAIVLRPGAGMHIDAHGLDTSILAQYVKHAQP 127 Query: 129 QSIIAFILNVIPNTIVGAFANGDILQVLMFSVLFGFALHRLGAYGKPVLDFIDRFAHVMF 188 ++AF L+VIP T++GAF GD+L VL+ S+LFGF+L+ G+PVL ID AHV+F Sbjct: 128 GGLVAFALSVIPETMLGAFEKGDVLPVLLLSLLFGFSLNSCPKAGRPVLALIDGVAHVLF 187 Query: 189 IIINMIMKLAPLGAFGAMAFTIGAYGVGSLVQLGQLMICFYITCVVFVLVVLGAICRAHG 248 I+ MIM+LAPLGAFGAMAFT+G +G+ S+ LG LM+CFY+ C++F+ +VL ++ R HG Sbjct: 188 RILAMIMRLAPLGAFGAMAFTVGRFGIRSVGSLGMLMVCFYVACLLFIALVLASLARLHG 247 Query: 249 FSVIKLIRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGYSFNLDGTS 308 F++ +L+RY+REELLIVL TSS+E LPR+++K+E LG K VVGLV+P GYSFNLDGT+ Sbjct: 248 FALWRLLRYMREELLIVLATSSTEPVLPRLIVKLEALGCDKGVVGLVLPAGYSFNLDGTA 307 Query: 309 IYLTMAAVFIAQATDTPMDLTHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSAVGHLPV 368 IYLT+A++FIAQA D P+ + +L V+LL+SKGAAGV+GSG + L ATL+ + LPV Sbjct: 308 IYLTLASMFIAQACDVPLSASQIAMMLAVMLLTSKGAAGVSGSGLVALVATLTVIPDLPV 367 Query: 369 AGLALILGIDRFMSEARALTNLVGNAVATIVVAKWVKELDEDQLQTEL--ASGGRGISDV 426 AG+AL++GIDRFMSEARALT+++ NA A I V+ W D +L L A+ G +D Sbjct: 368 AGVALLVGIDRFMSEARALTSVISNACAVIFVSMWEGACDRARLAQMLGAAAAPAGDADG 427 Query: 427 RED 429 ED Sbjct: 428 AED 430 Lambda K H 0.326 0.142 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 573 Number of extensions: 28 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 450 Length of database: 438 Length adjustment: 32 Effective length of query: 418 Effective length of database: 406 Effective search space: 169708 Effective search space used: 169708 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory