Align Putative UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate H281DRAFT_04843 H281DRAFT_04843 UDP-glucose 4-epimerase
Query= curated2:Q57664 (305 letters) >FitnessBrowser__Burk376:H281DRAFT_04843 Length = 310 Score = 201 bits (511), Expect = 2e-56 Identities = 114/305 (37%), Positives = 175/305 (57%), Gaps = 8/305 (2%) Query: 2 ILVTGGAGFIGSHIVDKLIENNYDVIILDNLTTGNKNNIN--PKAEFVNADIRD-KDLDE 58 I V GG GFIGS IVD+L+ + +++ + + G + ++ D+ D+ E Sbjct: 3 ITVFGGGGFIGSTIVDRLLRDGHEICVFERARVGPYRRFDNGEDVRWMTGDLMSVHDITE 62 Query: 59 KINFKDVEVVIHQAAQINVRNSVENPVYDGDINVLGTINILEMMRKYDIDKIVFASSGGA 118 I+ D+ V+H + ++S ++P+YD N++ T+++L M + KIVF SSGG Sbjct: 63 AIDSTDI--VVHLVSTTLPKSSNDDPIYDVQSNLVATLHLLNAMVAKSVKKIVFISSGGT 120 Query: 119 VYGEPNYLPVDENHPINPLSPYGLSKYVGEEYIKLYNRLYGIEYAILRYSNVYGERQDPK 178 VYG+P YLPVDE HP NP YG++K E+Y+ LY YGI+ ILR +N YGERQ + Sbjct: 121 VYGDPIYLPVDEKHPTNPKVSYGITKLAIEKYLLLYQYQYGIKANILRVANPYGERQRVE 180 Query: 179 GEAGVISIFIDKMLKNQSPIIFGDGNQTRDFVYVGDVAKANLMALNW--KNEIVNIGTGK 236 G I++F+DK L+ + I+GDG TRD++Y+GDVA+A A+ + + N+ +G Sbjct: 181 TAQGAIAVFLDKALRRRPIEIWGDGTITRDYLYIGDVAEAFARAVQYDGTESVFNVSSGY 240 Query: 237 ETSVNELFDIIKHEIGFRGEAIYDKPREGEVYRIYLDIKKAE-SLGWKPEIDLKEGIKRV 295 TS+NE+ I+ +G E Y R +V LD A+ L W P++DL GIK Sbjct: 241 GTSLNEIVGKIEAILGHPIERSYRPGRPFDVPASVLDNTLAKRELEWHPKVDLDAGIKMT 300 Query: 296 VNWMK 300 W++ Sbjct: 301 AAWLR 305 Lambda K H 0.317 0.140 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 303 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 310 Length adjustment: 27 Effective length of query: 278 Effective length of database: 283 Effective search space: 78674 Effective search space used: 78674 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory