Align galactaro-1,5-lactonase (characterized)
to candidate H281DRAFT_05322 H281DRAFT_05322 gluconolactonase (EC 3.1.1.17)
Query= reanno::WCS417:GFF3393 (291 letters) >FitnessBrowser__Burk376:H281DRAFT_05322 Length = 317 Score = 314 bits (804), Expect = 2e-90 Identities = 161/293 (54%), Positives = 190/293 (64%), Gaps = 17/293 (5%) Query: 13 VGECPVWVPGENALYWVDIPKGGLQRWSAATGHVAAWTAPQMLACIARTDAGNWVAGMET 72 VGE PVW E ALYWVDIP + R TG + W P+ +ACIA G +AG ET Sbjct: 22 VGESPVWRVAEQALYWVDIPAQKIVRLVVETGKRSEWLLPEKVACIAFDRRGTVLAGCET 81 Query: 73 GFFQLTPHNDGSLDTTL---------------LAAVEHPRQDMRLNDGRCDRQGRFWAGS 117 F +T + S D T LAA P DMR NDGRCDRQGRFWAG+ Sbjct: 82 ALFAVTL-SGSSTDATAQAVRASEPVEVTGRKLAAPVFPFDDMRFNDGRCDRQGRFWAGT 140 Query: 118 MVLNMGLNAAEGTLYRYTS-GAAPHAQLDGFITLNGLAFSPDGRTMYASDSHPLVQQIWA 176 MV +M L G LYR+ + G +DG IT NGL +SPDG+TMY SDSHPL +QIWA Sbjct: 141 MVQDMSLANPAGALYRFDAQGVLSAPVVDGLITQNGLGWSPDGKTMYLSDSHPLRRQIWA 200 Query: 177 FDYDIDTGTPSNRRVFVDMHKHLGRPDGAAVDADGCYWICANDAGLIHRFSPDGRLDRSL 236 FDY+++TG P+NRRVF D++ ++GRPDGAAVDADGCYWICANDAG + RF+P G+LDR + Sbjct: 201 FDYEVETGEPNNRRVFADLNHYVGRPDGAAVDADGCYWICANDAGALLRFTPQGKLDRQI 260 Query: 237 TVPVKKPTMCAFGGSRLDTLFVTSIRDDQSEQSLSGGVFALNPGVVGLPEPTF 289 VP KP MCAFGG LDTLFVTSIR G +FA+ PGV GLPEP F Sbjct: 261 AVPAIKPAMCAFGGRDLDTLFVTSIRPGAGASEHDGHLFAVRPGVSGLPEPEF 313 Lambda K H 0.321 0.137 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 291 Length of database: 317 Length adjustment: 27 Effective length of query: 264 Effective length of database: 290 Effective search space: 76560 Effective search space used: 76560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory