Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate H281DRAFT_06296 H281DRAFT_06296 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family
Query= reanno::pseudo6_N2E2:Pf6N2E2_5967 (272 letters) >FitnessBrowser__Burk376:H281DRAFT_06296 Length = 258 Score = 323 bits (827), Expect = 3e-93 Identities = 159/256 (62%), Positives = 193/256 (75%), Gaps = 1/256 (0%) Query: 18 RLKNKVVLLTGAAQGIGEAIVAAFASQQARLVISDIQAEKVETVAAHWR-ERGADVHALK 76 RL KV L+TGA +GIG AI AFA + A + ++++ + A E GA V A+ Sbjct: 3 RLAGKVALVTGAGRGIGAAIALAFAREGAAVALAELDIDTARQTAQQISSETGARVLAVH 62 Query: 77 ADVSNQQDLHAMARHAVERHGRIDVLVNCAGVNVFRDPLEMTEEDWRRCFAIDLDGAWYG 136 DV+ + A ++ G +DVLVN AG+NVF DPL MT++DWRRCFA+DLDG W G Sbjct: 63 TDVTQSASVQHAVSEAEKKLGPLDVLVNNAGINVFCDPLTMTDDDWRRCFAVDLDGVWNG 122 Query: 137 CKAVLPQMIEQGVGSIINIASTHSSHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVRVN 196 C+AVLP M+E+G GSI+NIASTH+ IIPGCFPYPVAKHG++GLTRALGIEYAP+ VRVN Sbjct: 123 CRAVLPGMVERGAGSILNIASTHAFKIIPGCFPYPVAKHGVIGLTRALGIEYAPRNVRVN 182 Query: 197 AIAPGYIETQLNVDYWNGFADPYAERQRALDLHPPRRIGQPIEVAMTAVFLASDEAPFIN 256 AIAPGYIETQL D+WN DP A RQ +DL P +RIG+P EVAMTAVFLASDEAPFIN Sbjct: 183 AIAPGYIETQLTHDWWNEQPDPAAARQATMDLQPMKRIGRPEEVAMTAVFLASDEAPFIN 242 Query: 257 ASCITIDGGRSVMYHD 272 A+CIT+DGGRSV+YHD Sbjct: 243 ATCITVDGGRSVLYHD 258 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 245 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 258 Length adjustment: 25 Effective length of query: 247 Effective length of database: 233 Effective search space: 57551 Effective search space used: 57551 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory