Align GlcU, component of Glucose, mannose, galactose porter (characterized)
to candidate H281DRAFT_01452 H281DRAFT_01452 carbohydrate ABC transporter membrane protein 2, CUT1 family
Query= TCDB::Q97UY9 (287 letters) >FitnessBrowser__Burk376:H281DRAFT_01452 Length = 305 Score = 134 bits (338), Expect = 2e-36 Identities = 87/282 (30%), Positives = 146/282 (51%), Gaps = 19/282 (6%) Query: 15 YLALAIVSVIWLIPVYAMLINGFKSNFEVLSTPVLVPPTKITFEAYVSVLLSLAKPLI-- 72 YL L ++ +L+P+Y ML+ FK E+ +L P T A+ + S L Sbjct: 33 YLFLLSAALFFLLPLYVMLVTSFKPMSEIRLGNLLALPAHFTLHAWSAAWESACTGLDCN 92 Query: 73 -------NSLIIVIPTSFISAFLGAMGAYFFYTLSYSFSRASSAISDVLFSLISLATFIP 125 NS+ IV+P++ S +GA+ Y + SF R A VLF ++ + FIP Sbjct: 93 GIQVGFWNSVRIVVPSTVFSIAIGAVNGY-----ALSFWRPRGA--GVLFGVLLMGAFIP 145 Query: 126 QEATLLPLTRLIVSMGLLDSYIGIIFALLIFYIPTGALLMSMFISVIPRSLIEAAKMDGT 185 + + PL R++ S+ L S GI+ IF +P LL + + IP+ L +AA++DG Sbjct: 146 VQVMVYPLVRVLASVHLFSSLPGIVVIHTIFGMPVMTLLFRNYYASIPQELFKAARIDGG 205 Query: 186 GDLKIFMKIVFPLSMPGFISTLIFIIIQAWNNFFIPLVLVTTPGMKLT-SIAVLSYSGAY 244 G +IF++++ P+S P + +I + WN+F + LV T + +T + + + Sbjct: 206 GFWRIFVQLMLPMSTPIIVVAVIMQVTGIWNDFILGLVFAGTKNLPMTVQLNNIINTTTG 265 Query: 245 GTLYNDTFAAGMVASIIPLAIFVFLGRYFIRGLMALGGGGKG 286 LYN AA ++ S++PLA++ GR+F+RG+ + G KG Sbjct: 266 ERLYNVNMAATILTSLVPLAVYFISGRWFVRGIAS--GAVKG 305 Lambda K H 0.330 0.144 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 254 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 287 Length of database: 305 Length adjustment: 26 Effective length of query: 261 Effective length of database: 279 Effective search space: 72819 Effective search space used: 72819 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory