Align Inner membrane ABC transporter permease protein YjfF (characterized)
to candidate H281DRAFT_02703 H281DRAFT_02703 monosaccharide ABC transporter membrane protein, CUT2 family
Query= SwissProt::P37772 (331 letters) >FitnessBrowser__Burk376:H281DRAFT_02703 Length = 333 Score = 167 bits (422), Expect = 4e-46 Identities = 106/286 (37%), Positives = 160/286 (55%), Gaps = 11/286 (3%) Query: 27 PGFASTRVICNILTDNAFLGIIAVGMTFVILSGGIDLSVGSVIAFTGVFLAKVI-----G 81 P F +T + NI+ + +GI AVG TFVI++ GIDLSVGS++A TG+ A V+ G Sbjct: 45 PEFLTTSTLTNIMVQVSVVGIAAVGGTFVIITSGIDLSVGSLVALTGMVAATVMAGSSPG 104 Query: 82 DFGLSPLLAFPLVLVMGCAFGAFMGLLIDALKIPAFIITLAGMFFLRGVSYLVSEESIPI 141 GL + L +G A GA GL + L++ FI+TLA M RG++ +S+ Sbjct: 105 AIGLG-IAGLCAALAVGAAAGALNGLAVAWLRLVPFIVTLAMMAMARGLTLAISDGRTKF 163 Query: 142 NHPIYDTLSSLAWKIPGGGRLSAMGLLMLAVVVIGIFLAHRTRFGNQVYAIGGNATSANL 201 + P + ++ K G L ++ML + VIG L +T FG+QV+A+GGN +A L Sbjct: 164 DFP--NAFTAFGAKTVAG--LPMPMIVMLVIFVIGHVLLRKTTFGHQVFAVGGNQEAARL 219 Query: 202 MGISTRSTTIRIYMLSTGLATLAGIVFSIYTQAGYALAGVGVELDAIASVVIGGTLLSGG 261 GI YML+ A +AGIV + + A G+EL IA+VVIGGT L+GG Sbjct: 220 AGIPVHRVVFLTYMLAGVTAAIAGIVLAGRLNSALPSAANGLELQVIAAVVIGGTSLAGG 279 Query: 262 VGTVLGTLFGVAIQGLIQTYINFDGTLSSWWTKIAIGILLFIFIAL 307 G+++GT GV + G+I ++ G ++ +WT+ G ++F + L Sbjct: 280 RGSIVGTFIGVVLIGVINVGLSLLG-VNPFWTQFIQGGVIFAAVLL 324 Lambda K H 0.329 0.145 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 351 Number of extensions: 31 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 333 Length adjustment: 28 Effective length of query: 303 Effective length of database: 305 Effective search space: 92415 Effective search space used: 92415 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory