Align Probable galactarate dehydratase (L-threo-forming); GalcD; EC 4.2.1.42 (uncharacterized)
to candidate H281DRAFT_03532 H281DRAFT_03532 altronate hydrolase
Query= curated2:P42240 (510 letters) >FitnessBrowser__Burk376:H281DRAFT_03532 Length = 441 Score = 166 bits (420), Expect = 2e-45 Identities = 124/393 (31%), Positives = 193/393 (49%), Gaps = 37/393 (9%) Query: 119 EGYRNADGSAGTKNILGITTSVQCVVGVLDYAVKRIKEELLPKYPNVDD-----VVPLHH 173 +GY +DG G +N++ + V+C V V +E L D P+H Sbjct: 17 QGYPRSDGRKGIRNVVAVAYLVECAHHVAREIVTEFREPLDAFGDTFADGSAGREPPVHL 76 Query: 174 QYGCGVAINAPDAVIPIRTIQNLAKHPNFGGEVMVIGLGCEKLLPERI-----ASENDDD 228 G N + ++ L HPN G V+ + LGCE + + AS + Sbjct: 77 IGFPGCYPNE----YAEKMLERLTTHPNVGA-VLFVSLGCESMNKHYLVDVVRASGRPVE 131 Query: 229 ILSLQDHRGFAAMIQSILEMAEERLIRLNSRTRVSCPVSDLVIGLQCGGSDAFSGVTANP 288 +L++Q+ G + IQ ++ +L ++ +V +S+LVIG CGGSD SG+TANP Sbjct: 132 VLTIQEKGGTRSTIQYGVDWVRGARKQLAAQEKVPMALSELVIGTICGGSDGTSGITANP 191 Query: 289 AVGYAADLLVRAGATVLFSEVTEVRDAIHLLTPRAVSEEVGQSLI----KEMKWYDSYLR 344 AVG A D L+ AGAT +F E E+ + RA E+G +++ K ++Y S L Sbjct: 192 AVGRAFDHLIDAGATCIFEETGELVGCEFHMKTRAARPELGDAIVACVAKAARYY-SILG 250 Query: 345 RGDADRSANPSPGNKKGGLSNVVEKALGSVAKSGTSPISGVLGPGERAKQKGLL------ 398 G + GN GGL+ EK+LG+ AKSG SPI+G++ PG+ GL Sbjct: 251 HGSF------AVGNADGGLTTQEEKSLGAYAKSGASPIAGIVKPGDIPPTGGLYLLDVVP 304 Query: 399 -----FAATPASDFVCGTLQLAAGMNLQVFTTGRGTPYGLAAAPVLKVSTRHSLSEHWAD 453 F SD +A G ++ +FTTGRG+ G A +PV+K+ + + A Sbjct: 305 DGEPRFGFPNISDNAEIGELIACGAHVILFTTGRGSVVGSAISPVIKICANPATYRNLAG 364 Query: 454 LIDINAGRIATGEASIEDVGWEIFRTILDVASG 486 +D++AGRI G ++++VG E+F + V+ G Sbjct: 365 DMDVDAGRILEGRGTLDEVGREVFEQTVAVSQG 397 Lambda K H 0.318 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 572 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 510 Length of database: 441 Length adjustment: 33 Effective length of query: 477 Effective length of database: 408 Effective search space: 194616 Effective search space used: 194616 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory