Align Senescence marker protein-30 family protein (characterized, see rationale)
to candidate H281DRAFT_01183 H281DRAFT_01183 Sugar lactone lactonase YvrE
Query= uniprot:Q888H2 (294 letters) >FitnessBrowser__Burk376:H281DRAFT_01183 Length = 293 Score = 170 bits (431), Expect = 3e-47 Identities = 109/289 (37%), Positives = 150/289 (51%), Gaps = 11/289 (3%) Query: 8 DAQNATGESPVWSVREQALYWVDIPNGELHRWDSSQDRTRSWKAPQMLACIAADSRGGWI 67 ++++A GESP+W R+Q LYW+D + D + R WK P + IA G + Sbjct: 11 ESRDALGESPLWDDRKQILYWIDSHARLVKARDMEANTLREWKMPSQIGAIALCESGRLL 70 Query: 68 AGMENGLYHLQPCDDGSLISTLLASVEHAQTGMRFNDGRCDRQGRFWAGTMLMDMAAGAV 127 + + L D G L T V H MR NDGR DR+GR G+M + A Sbjct: 71 VALVSSFVFLDT-DTGEL--TNFVDVTHPAPNMRLNDGRVDREGRLVLGSMALGRREPA- 126 Query: 128 VGALYRYSAGQKTLEAQLKDLIVPNGLAFSPDGKTMYLSDSHPAVQKIWAFDYDTDSGTP 187 G LY+ G+ L+ + + N FSPDG+ +Y SDS + +A Y + +GT Sbjct: 127 -GELYQLD-GEGNLKVLDTGICITNSTCFSPDGQYLYFSDSLSCQLRRYA--YHSSAGTL 182 Query: 188 HDRRLFVDMNNYLGRPDGAAIDADGCYWICGNDAGLVHRFTPNGKLDRSLVVPVKKPAMC 247 +R LFVD + PDGA IDADG W +G + RFTP+G+LDR + +P P Sbjct: 183 SERTLFVDTTSLKSGPDGATIDADGNLWTALVISGQLARFTPDGRLDRIIDLPTVYPTCP 242 Query: 248 AFGGPNLDTLFVTSIRPGGDL--SDQPLAGGVFALR-PGVKGLEEPVFQ 293 + GGP LDT+FVTSI G+ S P AG V A+ GV+GL E F+ Sbjct: 243 SIGGPALDTIFVTSISDSGNALKSQNPNAGAVVAITGTGVRGLPECRFK 291 Lambda K H 0.320 0.138 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 293 Length adjustment: 26 Effective length of query: 268 Effective length of database: 267 Effective search space: 71556 Effective search space used: 71556 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory