Align phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating) (EC 1.1.1.343) (characterized)
to candidate H281DRAFT_02800 H281DRAFT_02800 6-phosphogluconate dehydrogenase (decarboxylating)
Query= BRENDA::G5EBD7 (332 letters) >FitnessBrowser__Burk376:H281DRAFT_02800 Length = 345 Score = 335 bits (859), Expect = 1e-96 Identities = 176/344 (51%), Positives = 231/344 (67%), Gaps = 22/344 (6%) Query: 1 MRIGIIGLGRMGGNIAVRLTRHGHDVVVHDRTSEVTTSVVGRCEAGRATPADTLADMAKL 60 M++G+IGLGRMG ++ RLT+ G + +D V + V R A +L D+ Sbjct: 1 MQLGMIGLGRMGADMVRRLTKGGQQCIAYD----VQPAAVERLGQEGVLGASSLEDLVAK 56 Query: 61 LEGDEHRVVWVMLPAGAITEDCVQQLGGLLGRGDIIIDGGNTYYKDDVRRSAELAEKGIS 120 LE + R VW+M+PA A+ + + +L LL GDI+IDGGN+YY DD+RR A+LAE+ + Sbjct: 57 LE--KPRAVWLMVPA-AVVDGTLDKLLPLLEPGDIVIDGGNSYYHDDIRRGAQLAERKLH 113 Query: 121 YVDVGTSGGVWGLERGYCMMFGGTKETAEYIDPILSALAPGIGDVPRTPGRDEAGHDPRA 180 YVDVGTSGGV G ERGYC+M GG E + ++PI S LAPG P TPGR E A Sbjct: 114 YVDVGTSGGVAGRERGYCLMIGGEAEVVQRLEPIFSTLAPGAAAAPATPGRTEGSST--A 171 Query: 181 EQGYLHCGPAGSGHFVKMVHNGIEYGMMQAFAEGFDIMK------------SKNSPILA- 227 EQG+LHCGP G+GHFVKMVHNGIEYG+M A+AEG +I++ ++ SP+ Sbjct: 172 EQGFLHCGPIGAGHFVKMVHNGIEYGLMAAYAEGLNILRHADAGKHARDADAETSPLRRP 231 Query: 228 EKDRFELNMGDIAEVWRRGSVVSSWLLDLTAEALTRSETLNEFSGEVADSGEGRWTIEAA 287 E +++LN+ DIAEVWRRGSV+ SWLLDL A +L L ++G V+DSGEGRWT+ AA Sbjct: 232 ELYQYDLNLADIAEVWRRGSVIGSWLLDLIAGSLVGDADLKNYAGRVSDSGEGRWTMAAA 291 Query: 288 IEEDVPAPVMTAALFTRFRSRSGNNFAEKILSAQRFGFGGHVEK 331 ++E VPAPV++AALF RF SR +FA ++LSA R FGGH EK Sbjct: 292 VDEGVPAPVLSAALFGRFSSRGEADFANRVLSAMRHDFGGHAEK 335 Lambda K H 0.318 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 389 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 345 Length adjustment: 28 Effective length of query: 304 Effective length of database: 317 Effective search space: 96368 Effective search space used: 96368 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate H281DRAFT_02800 H281DRAFT_02800 (6-phosphogluconate dehydrogenase (decarboxylating))
to HMM TIGR00872 (gnd: 6-phosphogluconate dehydrogenase (decarboxylating) (EC 1.1.1.44))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00872.hmm # target sequence database: /tmp/gapView.27690.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00872 [M=299] Accession: TIGR00872 Description: gnd_rel: 6-phosphogluconate dehydrogenase (decarboxylating) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-127 410.9 0.0 1.7e-127 410.7 0.0 1.0 1 lcl|FitnessBrowser__Burk376:H281DRAFT_02800 H281DRAFT_02800 6-phosphoglucona Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Burk376:H281DRAFT_02800 H281DRAFT_02800 6-phosphogluconate dehydrogenase (decarboxylating) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 410.7 0.0 1.7e-127 1.7e-127 1 297 [. 1 336 [. 1 338 [. 0.99 Alignments for each domain: == domain 1 score: 410.7 bits; conditional E-value: 1.7e-127 TIGR00872 1 mklgliGlGrmGaniakrlakrghevvgydrdqdaveelkedraegvanlkellkrlsaprvvwvm 66 m+lg+iGlGrmGa++++rl+k+g ++++yd++++ave+l +++ g +l++l+ +l+ pr vw+m lcl|FitnessBrowser__Burk376:H281DRAFT_02800 1 MQLGMIGLGRMGADMVRRLTKGGQQCIAYDVQPAAVERLGQEGVLGASSLEDLVAKLEKPRAVWLM 66 9***************************************************************** PP TIGR00872 67 vpagivdavleelapllekGdividgGnsyykdslrrekelkekgihlldvGtsGGvlGkerGycl 132 vpa++vd l++l plle GdividgGnsyy+d++rr +l e+ +h++dvGtsGGv G+erGycl lcl|FitnessBrowser__Burk376:H281DRAFT_02800 67 VPAAVVDGTLDKLLPLLEPGDIVIDGGNSYYHDDIRRGAQLAERKLHYVDVGTSGGVAGRERGYCL 132 ****************************************************************** PP TIGR00872 133 miGGdeeafkkaeplfk.................dvaveekGylylGeaGsGhfvkmvhnGieyGl 181 miGG+ e+ ++ ep+f ++ e+G+l++G+ G+GhfvkmvhnGieyGl lcl|FitnessBrowser__Burk376:H281DRAFT_02800 133 MIGGEAEVVQRLEPIFStlapgaaaapatpgrteGSSTAEQGFLHCGPIGAGHFVKMVHNGIEYGL 198 ********************************987788999************************* PP TIGR00872 182 maalaeGlevlkns......................qfdfdleevarvyrrGsvirsflldltaka 225 maa aeGl++l+++ q+d +l ++a+v+rrGsvi+s+lldl+a + lcl|FitnessBrowser__Burk376:H281DRAFT_02800 199 MAAYAEGLNILRHAdagkhardadaetsplrrpelyQYDLNLADIAEVWRRGSVIGSWLLDLIAGS 264 ****************************************************************** PP TIGR00872 226 leesadleeveGrvedsGeGrwtvkaavdlgvpapvlatslqerfasrekddfankvlaalrkefG 291 l +adl++ Grv+dsGeGrwt+ aavd+gvpapvl+ +l rf+sr + dfan+vl+a+r++fG lcl|FitnessBrowser__Burk376:H281DRAFT_02800 265 LVGDADLKNYAGRVSDSGEGRWTMAAAVDEGVPAPVLSAALFGRFSSRGEADFANRVLSAMRHDFG 330 ****************************************************************** PP TIGR00872 292 ghaekk 297 ghaek+ lcl|FitnessBrowser__Burk376:H281DRAFT_02800 331 GHAEKP 336 ***997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (299 nodes) Target sequences: 1 (345 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.38 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory