GapMind for catabolism of small carbon sources

 

Alignments for a candidate for gntA in Paraburkholderia bryophila 376MFSha3.1

Align TRAP dicarboxylate transport system, small permease component (DctQ-like) (characterized, see rationale)
to candidate H281DRAFT_01744 H281DRAFT_01744 TRAP transporter, DctM subunit

Query= uniprot:G8AR26
         (179 letters)



>FitnessBrowser__Burk376:H281DRAFT_01744
          Length = 631

 Score = 57.8 bits (138), Expect = 4e-13
 Identities = 30/84 (35%), Positives = 49/84 (58%)

Query: 13  EWIMALMLAVMVALVFGNVVLRYGFNSGIVAAEELARLMFVWLVFLGATLALRRHQHLGL 72
           E++ A +LA  V +VF +V+ RY  +     AEE+A  + + LVF GA   L R QH+G+
Sbjct: 37  EYLCAAVLAADVLVVFLSVIYRYFLHDPFDWAEEVAGALMIVLVFFGAATVLARSQHVGV 96

Query: 73  DILQARLPARVRRACAVISHLLMI 96
           D+ +  LP R + A   + H +++
Sbjct: 97  DLFRGMLPMRWQPALVHVGHWVIV 120


Lambda     K      H
   0.331    0.141    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 214
Number of extensions: 12
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 179
Length of database: 631
Length adjustment: 28
Effective length of query: 151
Effective length of database: 603
Effective search space:    91053
Effective search space used:    91053
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory