Align ABC transporter substrate-binding protein (characterized, see rationale)
to candidate H281DRAFT_05324 H281DRAFT_05324 tripartite ATP-independent transporter solute receptor, DctP family
Query= uniprot:A0A165IVH1 (339 letters) >FitnessBrowser__Burk376:H281DRAFT_05324 Length = 331 Score = 147 bits (372), Expect = 3e-40 Identities = 88/284 (30%), Positives = 148/284 (52%), Gaps = 3/284 (1%) Query: 11 ALSVAAITCSFQAAAQDFKPRIIRFGYGLNEVSNQGRATKLFAEEVEKASGGKMKVRAIG 70 +L VAA +F A + R+ R + A K E+++ A+GGK V+ G Sbjct: 12 SLIVAASVLAF--GAMSAQARVFRVSDVHGDTYPTNMAVKYMGEQIKTATGGKDSVKVFG 69 Query: 71 AAALGSDVQMQQALIGGAQEMMVGSTATLVGITKEMAIWDTPFLFNNAKEADVVLDGPVG 130 +ALGS+ + GA +M + A I E I PFLF + V+ GP G Sbjct: 70 NSALGSENDTIDQVRIGALDMARANGAAFNEIVPESMIPSLPFLFRDIDHFRKVMYGPEG 129 Query: 131 QKVMDKLQEKGLVGLVYWENGFRNLTNSKRPVNKLEDMDGIKLRVMQNNVFLDSFKTLGA 190 QK++D + KG++ L ++E+G R++ +K+P+ DM G+K+RV +++ +D + +G Sbjct: 130 QKILDAFKAKGMIALTFYESGARSIY-TKKPIRTPADMKGLKVRVQPSDLMVDEIRAMGG 188 Query: 191 NAVPLPFSELFTALETKTVDGQENPYNTILSSKFYEVQKYLTVTNHVYSPWIVLVSKKYW 250 P+PF+E++T L+T VD EN + +K +EV + T H +P +++ SKK W Sbjct: 189 TPTPMPFAEVYTGLKTGLVDAAENNLPSYEETKHFEVAPVYSETQHSMTPEVLVFSKKVW 248 Query: 251 DGLSKAEQKVLLDAAKKSRDFERQDTRAEADKALADLKGKGMQV 294 D LS EQ+++ AA S + ++ A + A + G Q+ Sbjct: 249 DTLSPQEQEIIKKAAADSVPYYQKLWTARENDASKTVTKGGAQI 292 Lambda K H 0.316 0.130 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 331 Length adjustment: 28 Effective length of query: 311 Effective length of database: 303 Effective search space: 94233 Effective search space used: 94233 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory