Align ABC transporter for D-glucosamine, ATPase component (characterized)
to candidate H281DRAFT_00221 H281DRAFT_00221 amino acid ABC transporter ATP-binding protein, PAAT family
Query= reanno::pseudo3_N2E3:AO353_21725 (265 letters) >FitnessBrowser__Burk376:H281DRAFT_00221 Length = 259 Score = 244 bits (623), Expect = 1e-69 Identities = 129/256 (50%), Positives = 177/256 (69%), Gaps = 2/256 (0%) Query: 10 NASQALLEIRDLHKQYGPLEVLKGVDLTMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQG 69 N ++ L + +LHKQYG EVLKGV L G+V+++IGSSGSGK+T+LRC+N LE+ Sbjct: 2 NTTKQKLFVDELHKQYGDNEVLKGVTLKANAGDVISVIGSSGSGKSTMLRCINFLEQPNA 61 Query: 70 GQILLDGESIGYHEVNGKRVRHSE-KVIAQHRAMTGMAFQQFNLFPHLTALQNVTLGLLK 128 G+I +DGE + +R S+ K + + R M FQ FNL+ H+ L+N+ + Sbjct: 62 GRIFVDGEEVRTQIAKNGALRVSDPKQLQRVRTKLSMVFQHFNLWSHMNVLENIVEAPVN 121 Query: 129 VKKLHKDEAVVLAEKWLERVGLLERRD-HYPGQLSGGQQQRVAIARAIAMNPSLMLFDEV 187 V L + EA A ++LE+VGL R + YP LSGGQQQRVAIARA+AM+P +MLFDE Sbjct: 122 VLGLKRKEAEDRAREYLEKVGLAPRLEKQYPSHLSGGQQQRVAIARALAMHPDVMLFDEP 181 Query: 188 TSALDPELVGEVLSVIKGLAEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKEL 247 TSALDPELVGEVL V++ LAE+G TM++VTHEM FA VS+ ++F++QGR+EE+G P E+ Sbjct: 182 TSALDPELVGEVLKVMQTLAEEGRTMIVVTHEMAFARNVSNHVMFLHQGRVEEEGHPDEV 241 Query: 248 FERPQSPRLAEFLKNT 263 F +S RL +FL + Sbjct: 242 FRNTRSERLKQFLSGS 257 Lambda K H 0.319 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 259 Length adjustment: 25 Effective length of query: 240 Effective length of database: 234 Effective search space: 56160 Effective search space used: 56160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory