Align ABC transporter for D-Glucosamine, permease component 1 (characterized)
to candidate H281DRAFT_04157 H281DRAFT_04157 sorbitol ABC transporter membrane protein /mannitol ABC transporter membrane protein
Query= reanno::Smeli:SM_b21219 (281 letters) >FitnessBrowser__Burk376:H281DRAFT_04157 Length = 291 Score = 125 bits (315), Expect = 8e-34 Identities = 83/267 (31%), Positives = 141/267 (52%), Gaps = 12/267 (4%) Query: 16 ALLLAVVILAPVAWLLIMSISPAADLSAKPLAWWPSDIDLSRYRTLLSAVENSAGAAFIA 75 A +A+++ P+ W+ I + + L + P T S E A + + + Sbjct: 35 AWFVALLLFFPIFWMTITAFKTEQQAYSSSLFFTP---------TFDSFREVFARSNYFS 85 Query: 76 SLLNSIKVAGMATLAAVVVAVPAAWAVSRTPAVAWS--LYAVIATYMLPPVALAVPLYMG 133 NSI ++ T+ +++AVPAA+A++ P L +++T M+P V + VP+Y+ Sbjct: 86 FAWNSILISVGVTVLCLILAVPAAYAMAFFPTRRTQKVLLWMLSTKMMPSVGVLVPIYLL 145 Query: 134 LAYFGLLNSVFGLALVYLTILAPFTTWLLKSGFDSIPREIESAAMIDGARLDQILRILTL 193 GLL++V GL +VY I P W+ + F IPR+I A IDGA Q + L + Sbjct: 146 WKNSGLLDTVSGLVIVYTLINLPIAVWMSFTYFAEIPRDILEAGRIDGAATWQEIVYLLM 205 Query: 194 PLAAPVMATSALFAFLLAWDEFFYALLFTSDQRAKTLTVAIADLAGGRVSDYGLIATAGV 253 P+A P +A++AL +L+W+E F+++ +S A LTV IA + + ++ A + Sbjct: 206 PMALPGLASTALLLVILSWNEAFWSINLSS-SNAAPLTVFIASYSSPEGLFWAKLSAASL 264 Query: 254 LAALPPVLIGLIMQRALISGLTSGGVK 280 LA P +++G + Q+ L+ GLT G VK Sbjct: 265 LAVAPILIVGWLSQKQLVRGLTFGAVK 291 Lambda K H 0.325 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 255 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 291 Length adjustment: 26 Effective length of query: 255 Effective length of database: 265 Effective search space: 67575 Effective search space used: 67575 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory