Align ABC transporter for D-Glucosamine, permease component 2 (characterized)
to candidate H281DRAFT_03746 H281DRAFT_03746 carbohydrate ABC transporter membrane protein 1, CUT1 family
Query= reanno::Smeli:SM_b21220 (293 letters) >FitnessBrowser__Burk376:H281DRAFT_03746 Length = 296 Score = 169 bits (429), Expect = 5e-47 Identities = 92/275 (33%), Positives = 142/275 (51%) Query: 11 WLLMLPLLVVMTAVIGWPLVDTVRLSFTDAKLVGTEGGFVGTANYIKMLGGSNFQRALVT 70 WLL+ P LV+ +I +P+ + V S + G F G N+ + G F A Sbjct: 13 WLLIAPSLVLALFIISYPIFNIVWQSLHEVSRFGAIRDFTGLQNFYTIFGDPAFLAAARR 72 Query: 71 TTWFAVISVAAEMVLGVLAALLLNQQFRGRTALRALMILPWALPTVVNATLWRLIYNPEY 130 T + V V +++ V AL+LNQ F GR R +++LPW++ + A +WR +N +Y Sbjct: 73 TIVWTVFVVGGTVLISVPVALVLNQDFYGRGVARTIVMLPWSVSLTMTAVVWRWAFNDDY 132 Query: 131 GALNAALTQLGLLDSYRSWLGEPGTALAALIVADCWKNFPLVALIALAALQAVPRDITAA 190 G +N L +LGL+ WL P A I + P I L L +VP DI A Sbjct: 133 GMVNVTLQRLGLIGGPIHWLATPEFAFPVEIAVGILVSIPFTVTILLGGLSSVPGDIYEA 192 Query: 191 SLVDGAGPFNRFRFVIMPYLAGPLLVALVLRTIEAFKVFDIIWVMTRGGPANSTRTLSIL 250 + +DGA + +FR + +P L + + ++L I F F IIWVMT+GGP NST L Sbjct: 193 ARIDGASAWQQFRKLTLPLLRPFINMTILLNVIYVFNSFPIIWVMTQGGPDNSTHILVTY 252 Query: 251 VYQEAFSFQRAGSGASLALIVTLLVTILAAAYAAL 285 +Y+ F R G A+++LI+ +++ + + AY L Sbjct: 253 LYELGFRLGRPGEAAAVSLIMLVMLFVFSMAYLRL 287 Lambda K H 0.326 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 293 Length of database: 296 Length adjustment: 26 Effective length of query: 267 Effective length of database: 270 Effective search space: 72090 Effective search space used: 72090 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory