Align N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)
to candidate H281DRAFT_05701 H281DRAFT_05701 glycerol 3-phosphate ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc02869 (352 letters) >FitnessBrowser__Burk376:H281DRAFT_05701 Length = 362 Score = 311 bits (797), Expect = 2e-89 Identities = 179/360 (49%), Positives = 225/360 (62%), Gaps = 31/360 (8%) Query: 17 VGSLQLKTIRKAF-GSHEVLKGIDLDVKDGEFVIFVGPSGCGKSTLLRTIAGLEDATSGS 75 + +L L+ ++K + G VL GID+DV DGEFV+ VGPSGCGKSTLLR +AGLE + G+ Sbjct: 1 MAALTLQGVKKTYDGKQFVLHGIDVDVNDGEFVVMVGPSGCGKSTLLRMVAGLERISEGT 60 Query: 76 VQIDGVEVGHVAPAKRGIAMVFQSYALYPHLTVKDNMGLGLKQAGVPKAEIEEKVAKAAG 135 + I G V + P R IAMVFQ+YALYPH++V +NMG LK AGV +A+I ++V AA Sbjct: 61 ISIAGKVVNELEPKDRNIAMVFQNYALYPHMSVAENMGYALKIAGVDRAQIAQRVNAAAQ 120 Query: 136 MLSLEPYLARRPAELSGGQRQRVAIGRAIVREPKLFLFDEPLSNLDAALRVNTRLEIARL 195 +L LEP L R+P ELSGGQRQRVA+GRAIVREP +FLFDEPLSNLDA LRV RLEI RL Sbjct: 121 ILELEPLLQRKPRELSGGQRQRVAMGRAIVREPAVFLFDEPLSNLDARLRVQMRLEIQRL 180 Query: 196 HRSLKATMIYVTHDQVEAMTLADKIVVLNAGRIEQVGSPMELYNRPANLFVAGFIGSPQM 255 H L T +YVTHDQ+EAMTLA +++V+N G EQ+G+P E+Y RPA +FVAGFIGSP M Sbjct: 181 HARLATTSLYVTHDQIEAMTLAQRVIVMNKGHAEQIGAPTEVYERPATVFVAGFIGSPGM 240 Query: 256 NFIEAAKLGDGE-----------------------AK----TIGIRPEHIGLSRESGDWK 288 N +E DG AK T+GIRPEH+ + Sbjct: 241 NLLEGRVSDDGSTFDVAGNGPQLPLAGVASIGREVAKGREWTLGIRPEHMSPGQADAPHT 300 Query: 289 GKVI-HVEHLGADTIIYIESETVGLLTVRLFGEHRYATDDIVHATPVIGSMHRFD-ADGR 346 + E LGAD + + +T RL HR A + + +H FD A GR Sbjct: 301 TLTVDSCELLGADNLAHGRWGKHD-VTARLPHAHRPAAGEALQVALPARHLHFFDPASGR 359 Lambda K H 0.320 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 358 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 362 Length adjustment: 29 Effective length of query: 323 Effective length of database: 333 Effective search space: 107559 Effective search space used: 107559 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory