Align Glucosaminate ammonia-lyase; EC 4.3.1.9; D-glucosaminate dehydratase alpha-subunit; GlcNA-DH alpha subunit; GlcNADH-alpha (uncharacterized)
to candidate H281DRAFT_02889 H281DRAFT_02889 alkyl hydroperoxide reductase subunit F
Query= curated2:Q93HX6 (320 letters) >FitnessBrowser__Burk376:H281DRAFT_02889 Length = 530 Score = 152 bits (384), Expect = 2e-41 Identities = 105/317 (33%), Positives = 161/317 (50%), Gaps = 21/317 (6%) Query: 10 IILGSGPAGYSAAVYAARANLKPLLITGMQA---GGQLTTTTEVDNWPGDVHGLTGPALM 66 +I+G GPAG +AA+Y+AR + TG+ A GGQ+ T ++N+ V GP Sbjct: 216 LIVGGGPAGAAAAIYSARKGIA----TGVVAERFGGQVLDTLAIENFVS-VTETEGPKFA 270 Query: 67 ERMREHAERFETEIV-FDHINAVDFAAKPYTLTGDSATYTCDALIIATGASARYLGLPSE 125 + +H + +E +I+ A+ + A +I+ATGA R + +P E Sbjct: 271 TALEQHVKTYEVDIMDVQRAEALIPGRINEVRLANGAVLKAKTIILATGARWREINVPGE 330 Query: 126 EAFMGKGVSACATCDGFFYRNKPVAVVGGGNTAVEEALYLANIASTVTLIHRRETFRAEK 185 + GV+ C CDG ++ K VAV+GGGN+ VE A+ LA I VTL T RA++ Sbjct: 331 REYRNHGVAYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVREVTLFEFGATLRADE 390 Query: 186 ILIDKLNARVAEGKIILKLNANLDEVLGDNMGVTGARLKN-NDGSFDELKVDGVFIAIGH 244 +L KL + + + A E+ GD V G K+ G ++++GVF+ IG Sbjct: 391 VLQRKLRSL---ANVTIVTQAQTTEITGDGKKVNGLVYKDLRSGEVKNVELEGVFVQIGL 447 Query: 245 TPNTSLFEGQLTL-KDGYLVVQGGRDGNATATSVEGIFAAGDVADHVYRQAITSAGAGCM 303 PNT +G + L K G +VV ATSV G+FAAGDV ++Q + + G G Sbjct: 448 VPNTEWLKGTVELSKHGEIVVDA-----RGATSVPGVFAAGDVTTVPFKQIVIAVGEGAK 502 Query: 304 AALDTERYLDGLQNASE 320 A+L +L ++N+ E Sbjct: 503 ASLSAFDHL--IRNSEE 517 Lambda K H 0.318 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 320 Length of database: 530 Length adjustment: 31 Effective length of query: 289 Effective length of database: 499 Effective search space: 144211 Effective search space used: 144211 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory