Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate H281DRAFT_05492 H281DRAFT_05492 putative spermidine/putrescine transport system ATP-binding protein
Query= BRENDA::Q97UY8 (353 letters) >FitnessBrowser__Burk376:H281DRAFT_05492 Length = 372 Score = 206 bits (523), Expect = 1e-57 Identities = 115/314 (36%), Positives = 187/314 (59%), Gaps = 23/314 (7%) Query: 16 GKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKL 75 G+ + + ++N++I GE +LG SG+GKTT + ++AG + P+ G ++ NGK Sbjct: 18 GENLVVKDLNLSIRRGEFLTLLGASGSGKTTTLMMLAGFETPTLGGIWM-------NGKP 70 Query: 76 I--VPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHV 133 I VP R IGMVFQ +AL+P++T +N+A+PL +S+ E +V+ ++ +H + Sbjct: 71 IETVPAHKRGIGMVFQNYALFPHMTVEQNLAYPLRMRNVSRNETVAKVKRAVDMVRLHGM 130 Query: 134 LNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVT 193 P ELSGGQQQRVALARA+V +P L+L+DEP LD +R+ + +K++ LGVT Sbjct: 131 ERRRPSELSGGQQQRVALARAMVFEPELILMDEPLGALDKNLREHMQYEIKQLHHELGVT 190 Query: 194 LLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTN 253 ++ V+HD A+ ++DR+ V +G + Q+G P++LY+ P ++ VAS IGE N L G V + Sbjct: 191 VVYVTHDQAEAMTMSDRIAVFQQGVISQIGSPDELYERPANLDVASFIGESNRLTGTVVS 250 Query: 254 EGVVIGSLRFPVSVS-----------SDRAI-IGIRPEDVKLSKDVIKDDSWILVGKGKV 301 G ++ ++R +S DR + I +RPE V + + DD W + +G+V Sbjct: 251 VGSMVDTVRLTSGLSLEVPSTSPVREIDRVVEIVVRPERVSIEQG-SADDQWQWL-QGRV 308 Query: 302 KVIGYQGGLFRITI 315 + Y G R+ + Sbjct: 309 SDLTYLGDHLRVLL 322 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 282 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 372 Length adjustment: 29 Effective length of query: 324 Effective length of database: 343 Effective search space: 111132 Effective search space used: 111132 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory