Align D-galactarolactone cycloisomerase (EC 5.5.1.27) (characterized)
to candidate H281DRAFT_01747 H281DRAFT_01747 D-galactarolactone isomerase
Query= BRENDA::A9CEQ7 (292 letters) >FitnessBrowser__Burk376:H281DRAFT_01747 Length = 271 Score = 158 bits (399), Expect = 1e-43 Identities = 87/267 (32%), Positives = 137/267 (51%), Gaps = 8/267 (2%) Query: 20 GAVDTQMHMYLPGYPALPGGPGLPPGALPGPED-YRRLMQWLGIDRVIITQGNAHQRDNG 78 GA D +H+Y GYP PP P P YR + + LG+ R I+ Q + DN Sbjct: 9 GACDCHIHVYEEGYPLAASATFTPP---PAPASAYREVQRGLGLSRAIVVQPTGYGFDNR 65 Query: 79 NTLACVAEMGEAAHAVVIIDATTTEKDMEKLTAAGTVGARIMDLPGGAVNLSELDAVDER 138 TLA +A++G+ A V ++ ++ ++++L AG G R M L GG + S ++ + R Sbjct: 66 CTLAAIAQLGDGARGVAVVPPDVSDDELQRLHVAGIRGVRFMMLSGGVLPWSVIEDMSAR 125 Query: 139 AHAADWMVAVQFDGNGLLDHLPRLQKIRSRWVFDHHGKFFKGIRTDGPEMAALLKLIDRG 198 W + +Q DG+ L + L + S V DH GKF + + +L +L+D Sbjct: 126 IAPMGWNINLQLDGHTLPAYEAMLASLPSNLVIDHLGKFLAPVTPESEGFTSLCRLLDGP 185 Query: 199 NLWFKFAGVYESSRKSWP-YADVAAFSRVIAAHAPERIVWGTNWPHNSVRETAAYPDDAR 257 W K + YESSR P + DV+ R +++ PER VW +NWPH +V+ PD+AR Sbjct: 186 RCWIKLSAPYESSRNGSPDFDDVSWLVRTLSSRFPERGVWASNWPHPNVKPV---PDNAR 242 Query: 258 LAELTLGWLPDEAARHRALVENPEALF 284 + + T+ + R + LV+NP L+ Sbjct: 243 MLDWTMRLTESDEVRRKMLVDNPAELY 269 Lambda K H 0.319 0.136 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 271 Length adjustment: 26 Effective length of query: 266 Effective length of database: 245 Effective search space: 65170 Effective search space used: 65170 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory