Align D-galactarolactone cycloisomerase (EC 5.5.1.27) (characterized)
to candidate H281DRAFT_05538 H281DRAFT_05538 D-galactarolactone isomerase
Query= BRENDA::A9CEQ7 (292 letters) >FitnessBrowser__Burk376:H281DRAFT_05538 Length = 276 Score = 149 bits (376), Expect = 7e-41 Identities = 92/278 (33%), Positives = 136/278 (48%), Gaps = 12/278 (4%) Query: 14 NPAF---PRGAVDTQMHMY-LPGYPALPGGPGLPPGALPGPEDYRRLMQWLGIDRVIITQ 69 N AF P A D +H+Y L Y PP A DY +++Q LG+ R I+ Q Sbjct: 2 NDAFANMPDNACDCHVHIYELERYQLASTSTYGPPQA--SWSDYEKVLQRLGLTRAILVQ 59 Query: 70 GNAHQRDNGNTLACVAEMGEAAHAVVIIDATTTEKDMEKLTAAGTVGARIMDLPG--GAV 127 + DN L + G A +V+I T+ +++ + AG G R M +PG G + Sbjct: 60 PTGYAYDNRCLLEALQMSGGVARGIVVIKPDTSPAELQAMHDAGVRGVRFMMIPGSGGIL 119 Query: 128 NLSELDAVDERAHAADWMVAVQFDGNGLLDHLPRLQKIRSRWVFDHHGKFFKGIRTDGPE 187 +L+ + R W+V +Q DG L + RL+ + DH GKF + + TD Sbjct: 120 AWDDLEEIAGRIAEFGWVVNLQLDGRELAQYEARLRALPCLLTIDHIGKFLEPVATDHSG 179 Query: 188 MAALLKLIDRGNLWFKFAGVYESSRKSWP-YADVAAFSRVIAAHAPERIVWGTNWPHNSV 246 +LL L+D G W K + YE+S+ P Y DV+ +R + H PER +W +NWPH Sbjct: 180 FRSLLNLLDAGRTWVKVSAPYETSKIGPPLYDDVSTLARALIEHNPERCLWASNWPHPGR 239 Query: 247 RETAAYPDDARLAELTLGWLPDEAARHRALVENPEALF 284 + A +DA + L W PDE+ R + L NP AL+ Sbjct: 240 KSRA---NDAEMLALLSHWAPDESVRRQILASNPAALY 274 Lambda K H 0.319 0.136 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 276 Length adjustment: 26 Effective length of query: 266 Effective length of database: 250 Effective search space: 66500 Effective search space used: 66500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory