Align D-mannonate dehydratase (EC 4.2.1.8) (characterized)
to candidate H281DRAFT_02953 H281DRAFT_02953 D-mannonate dehydratase (EC 4.2.1.8)
Query= metacyc::MONOMER-17955 (360 letters) >FitnessBrowser__Burk376:H281DRAFT_02953 Length = 353 Score = 400 bits (1028), Expect = e-116 Identities = 195/355 (54%), Positives = 250/355 (70%), Gaps = 12/355 (3%) Query: 1 MKLVFRWYGEKHDTVTLEQIRQIPGVEGVVGALFDIPVGEVWPFEEIMKLKETVEKAGLK 60 +K+ FRWYG+ D V L IRQIPG+ GVV A++D+PVG+VWP + I LKE +E GL Sbjct: 1 LKMTFRWYGDA-DPVPLAYIRQIPGMVGVVSAVYDVPVGDVWPVDTIRSLKEKIEAHGLT 59 Query: 61 LEVIESVNVHEDIKLGLPTRDRYIENYKKTIRNLAKAGVKVVCYNFMPVFDWMRTDLHKK 120 L+VIESV VHEDIKLG PTRD I NY +T+RNL GVKVVCYNFMPVFDW RT L Sbjct: 60 LDVIESVPVHEDIKLGKPTRDTLIANYGQTLRNLGACGVKVVCYNFMPVFDWTRTSLEMP 119 Query: 121 LPDGSETMEYDHRLIEGVTPDELIKRVKEGSQGFVLPGWEWD-RLEKLRETFELYKNVDE 179 LPDGS T+ +D + I R + SQG LPGW+ R E+L+ Y+ +DE Sbjct: 120 LPDGSTTLAFDTQAI----------RELDVSQGIQLPGWDASYRPEQLKALLREYEALDE 169 Query: 180 EKLFENLVYFLERVIPVCEECDVKLAIHPDDPPWSIFGLPRIITNKENIERMLKAVDSPY 239 L+ NL YFL +IPV +E +K+AIHPDDPP IFGLPRI+ N+ +++R+L VD P Sbjct: 170 AGLWANLDYFLRAIIPVAKEAGIKMAIHPDDPPRPIFGLPRIVKNRADLQRVLAIVDDPA 229 Query: 240 NGITFCMGSLGANPENNIPEMIRYFGKMGRIHFAHVRNLKFTGEKSFYETAHPSFCGSHD 299 NG+T C GSLGA+ +N+IP ++R FG GRIHFAH+RN++ F+ET+H S GS D Sbjct: 230 NGLTLCSGSLGADLQNDIPALVREFGARGRIHFAHLRNVQTNAAGDFHETSHRSADGSLD 289 Query: 300 LFEVMKAFHDIGYEGYIRPDHGRLIWGEKARPGYGLYDRALGATYILGLWEAIDK 354 + E++KA+ + G+EGY RPDHGR+IWGE R GYGL+DRALGA Y+ G+WE + K Sbjct: 290 MAEIVKAYFETGFEGYARPDHGRMIWGETGRAGYGLFDRALGAVYLNGIWEGLAK 344 Lambda K H 0.322 0.142 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 468 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 353 Length adjustment: 29 Effective length of query: 331 Effective length of database: 324 Effective search space: 107244 Effective search space used: 107244 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate H281DRAFT_02953 H281DRAFT_02953 (D-mannonate dehydratase (EC 4.2.1.8))
to HMM TIGR00695 (uxuA: mannonate dehydratase (EC 4.2.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00695.hmm # target sequence database: /tmp/gapView.1917256.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00695 [M=394] Accession: TIGR00695 Description: uxuA: mannonate dehydratase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-124 402.5 0.0 3e-66 210.1 0.0 2.0 2 lcl|FitnessBrowser__Burk376:H281DRAFT_02953 H281DRAFT_02953 D-mannonate dehy Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Burk376:H281DRAFT_02953 H281DRAFT_02953 D-mannonate dehydratase (EC 4.2.1.8) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 190.7 0.0 2.3e-60 2.3e-60 2 138 .. 2 139 .. 1 142 [. 0.98 2 ! 210.1 0.0 3e-66 3e-66 180 389 .. 144 344 .. 138 348 .. 0.94 Alignments for each domain: == domain 1 score: 190.7 bits; conditional E-value: 2.3e-60 TIGR00695 2 eqtfrwyGrndpvsledvrqa.GakGivtalhhipnGevweveeikkrkeeiedaGlsasvvesvp 66 ++tfrwyG dpv l+++rq+ G+ G+v a++++p+G+vw v+ i+ ke+ie Gl+ +v+esvp lcl|FitnessBrowser__Burk376:H281DRAFT_02953 2 KMTFRWYGDADPVPLAYIRQIpGMVGVVSAVYDVPVGDVWPVDTIRSLKEKIEAHGLTLDVIESVP 67 79**************************************************************** PP TIGR00695 67 vheeiklqteeyekyienykqtlrnlaqcGikvvcynfmpvldwtrtdlayeledGskalrfdkik 132 vhe+ikl++ ++ i+ny qtlrnl cG+kvvcynfmpv+dwtrt l+ +l+dGs++l fd + lcl|FitnessBrowser__Burk376:H281DRAFT_02953 68 VHEDIKLGKPTRDTLIANYGQTLRNLGACGVKVVCYNFMPVFDWTRTSLEMPLPDGSTTLAFDTQA 133 ****************************************************************99 PP TIGR00695 133 vaalel 138 + l++ lcl|FitnessBrowser__Burk376:H281DRAFT_02953 134 IRELDV 139 998885 PP == domain 2 score: 210.1 bits; conditional E-value: 3e-66 TIGR00695 180 glpGaeegekldrikelleaykdideeklrenlafflkeilpvaeevGvkmaihpddpprpilGlp 245 lpG++ ++ +++k ll y +de+ l+ nl +fl++i+pva+e G+kmaihpddpprpi+Glp lcl|FitnessBrowser__Burk376:H281DRAFT_02953 144 QLPGWDASYRPEQLKALLREYEALDEAGLWANLDYFLRAIIPVAKEAGIKMAIHPDDPPRPIFGLP 209 59**************************************************************** PP TIGR00695 246 rivstiedmkklveisdspangitlctGsyGvradndlvelakqfa..driyfahlrsvkreenpk 309 riv +d++++ +i+d pang+tlc+Gs+G+ +nd+ l+++f+ +ri+fahlr+v+ + + lcl|FitnessBrowser__Burk376:H281DRAFT_02953 210 RIVKNRADLQRVLAIVDDPANGLTLCSGSLGADLQNDIPALVREFGarGRIHFAHLRNVQTNAAG- 274 *********************************************94457************999. PP TIGR00695 310 tfheaahlekdvdlyevvkavleeehrrkaeGkedlipvrpdhGrqllddlkkktnpGysaigrlk 375 +fhe++h + d++l + +++ + eG + rpdhGr +++ + + Gy++++r++ lcl|FitnessBrowser__Burk376:H281DRAFT_02953 275 DFHETSHRSADGSLD--MAEIVKAYFETGFEG----Y-ARPDHGRMIWG---ETGRAGYGLFDRAL 330 **********99877..666677777778899....6.8**********...99************ PP TIGR00695 376 GlaelrGlelalkk 389 G ++l+G++ l k lcl|FitnessBrowser__Burk376:H281DRAFT_02953 331 GAVYLNGIWEGLAK 344 *********98765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (394 nodes) Target sequences: 1 (353 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.77 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory