Align Uncharacterized protein (characterized, see rationale)
to candidate H281DRAFT_03238 H281DRAFT_03238 6-phosphogluconolactonase
Query= uniprot:Q881W7 (359 letters) >FitnessBrowser__Burk376:H281DRAFT_03238 Length = 366 Score = 249 bits (635), Expect = 1e-70 Identities = 139/353 (39%), Positives = 204/353 (57%), Gaps = 20/353 (5%) Query: 3 AATFAYISSPADGLISQYRLDEQSGALSLVEQTKAGDQVNPMAISPDGKALFAALRSKPY 62 AAT+AY+S+ IS + LD +GAL VE V PMA+SP+ L+A +RSKPY Sbjct: 25 AATYAYMSNADSQDISVFSLDTANGALKPVETVGLAGTVMPMALSPNHLRLYAGVRSKPY 84 Query: 63 QVLSFSIEPATGHLKPLSQAPLAESLAYLSTDRSGRFLFGASYGADLLSVQPIDAQHRPS 122 +V+SF+I P G L L +APLAES+AY+STD SGR+LF ASYG +LL+V ID+ Sbjct: 85 RVVSFAINPLDGRLSELGKAPLAESMAYVSTDASGRYLFSASYGGNLLAVNSIDSNGVAL 144 Query: 123 DSIETYKTGMHAHSVRTDPSNRFVYAGNLGVDRVLQYRLEPKDGKLVPIGEGFVAVPDNT 182 D + KTG AH++R P NR+V+A LG D L+ + +P G L ++ + Sbjct: 145 DVQQIIKTGPMAHAIRNAPDNRYVFASVLGSDAWLRLKFDPSKGSLTEDATPAYSLAAKS 204 Query: 183 GPRHLAFSSDGRFLYVVGEMSGTVTAFLINEKTGALKQVSQADGIPARLKLAPGQARDAR 242 GPRH FS D RF+Y++ E+ G + + + ++K V +P Sbjct: 205 GPRHFVFSPDHRFVYLIDELDGKLHVLAFDNQRDSVKPVQTISILPP------------- 251 Query: 243 NNDLKDDPTPRIWAADIRLAPDGKWLFISERTTSSVSVFKVDPAKGNVTFVENYPVEEKQ 302 N D P W AD+ + PDG++++ SERT+S+++ ++V+ A G +T + Y EKQ Sbjct: 252 -NFSGDKP----WGADVHITPDGRFVYASERTSSTLAAYRVERASGKLTRIGTY-ATEKQ 305 Query: 303 PRNIAVSPNGRWLLVSGEKSDKVGSYAIG-ASGALKRVSEAPSGKGALWIEML 354 PR V P+G +LL G+ S + +Y I +GAL + + P GKGA WIE++ Sbjct: 306 PRGFNVDPSGNYLLAVGQLSTSLSAYRIDPKTGALSALGQYPVGKGANWIEIV 358 Lambda K H 0.314 0.132 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 493 Number of extensions: 37 Number of successful extensions: 16 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 359 Length of database: 366 Length adjustment: 29 Effective length of query: 330 Effective length of database: 337 Effective search space: 111210 Effective search space used: 111210 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory