Align Glutamate/aspartate import permease protein GltJ (characterized)
to candidate H281DRAFT_04269 H281DRAFT_04269 L-glutamate ABC transporter membrane protein /L-aspartate ABC transporter membrane protein
Query= SwissProt::P0AER3 (246 letters) >FitnessBrowser__Burk376:H281DRAFT_04269 Length = 246 Score = 332 bits (852), Expect = 3e-96 Identities = 162/247 (65%), Positives = 197/247 (79%), Gaps = 2/247 (0%) Query: 1 MSIDWNWGIFLQQAPFGN-TTYLGWIWSGFQVTIALSICAWIIAFLVGSFFGILRTVPNR 59 MS WNWGI L G TTYLGW+ SGF VTI +S+ AW+IA +VGS FG+LRTVPN+ Sbjct: 1 MSYHWNWGILLSPVSTGEPTTYLGWLLSGFWVTITVSLSAWVIALIVGSLFGVLRTVPNK 60 Query: 60 FLSGLGTLYVELFRNVPLIVQFFTWYLVIPELLPEKIGMWFKAELDPNIQFFLSSMLCLG 119 + SG+GTLYV +FRN+PLIVQFF WYLVIPELLP +G WFK +L P QFF SS++CLG Sbjct: 61 WASGIGTLYVAIFRNIPLIVQFFIWYLVIPELLPVSMGTWFK-QLPPGAQFFSSSIICLG 119 Query: 120 LFTAARVCEQVRAAIQSLPRGQKNAALAMGLTLPQAYRYVLLPNAYRVIVPPMTSEMMNL 179 LFTAARVCEQVR+ I +LPRGQ+ A LAMG T Q YRYVLLP AYR+IVPP+TSE +N+ Sbjct: 120 LFTAARVCEQVRSGINALPRGQRAAGLAMGFTQWQTYRYVLLPVAYRIIVPPLTSEFLNI 179 Query: 180 VKNSAIASTIGLVDMAAQAGKLLDYSAHAWESFTAITLAYVLINAFIMLVMTLVERKVRL 239 KNSA+ASTIGL+D++AQA +L+DY++ +ESF A+TLAYVLIN +M +M VE K RL Sbjct: 180 FKNSAVASTIGLLDLSAQARQLVDYTSQTYESFIAVTLAYVLINLVVMQLMRWVEAKTRL 239 Query: 240 PGNMGGK 246 PG +GGK Sbjct: 240 PGYIGGK 246 Lambda K H 0.328 0.140 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 276 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 246 Length of database: 246 Length adjustment: 24 Effective length of query: 222 Effective length of database: 222 Effective search space: 49284 Effective search space used: 49284 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory