Align Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized)
to candidate H281DRAFT_04267 H281DRAFT_04267 L-glutamate ABC transporter ATP-binding protein /L-aspartate ABC transporter ATP-binding protein
Query= TCDB::P0AAG3 (241 letters) >FitnessBrowser__Burk376:H281DRAFT_04267 Length = 241 Score = 393 bits (1010), Expect = e-114 Identities = 198/241 (82%), Positives = 218/241 (90%) Query: 1 MITLKNVSKWYGHFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIKTVNGLEPVQQGEITV 60 MI++KNVSKWYG FQVLTDC+TEVKKGEVVVVCGPSGSGKSTLIKTVNGLEP Q+GEI + Sbjct: 1 MISIKNVSKWYGQFQVLTDCTTEVKKGEVVVVCGPSGSGKSTLIKTVNGLEPFQKGEIVI 60 Query: 61 DGIVVNDKKTDLAKLRSRVGMVFQHFELFPHLSIIENLTLAQVKVLKRDKAPAREKALKL 120 +G + DKKT+L+KLRS+VGMVFQHFELFPHLSI++NLTLAQ+KVL R K A K LKL Sbjct: 61 NGQSLTDKKTNLSKLRSKVGMVFQHFELFPHLSIVQNLTLAQIKVLGRSKDEASAKGLKL 120 Query: 121 LERVGLSAHANKFPAQLSGGQQQRVAIARALCMDPIAMLFDEPTSALDPEMINEVLDVMV 180 L+RVGL AHA+KFP QLSGGQQQRVAIARAL MDPIAMLFDEPTSALDPEMINEVLDVMV Sbjct: 121 LDRVGLRAHADKFPGQLSGGQQQRVAIARALSMDPIAMLFDEPTSALDPEMINEVLDVMV 180 Query: 181 ELANEGMTMMVVTHEMGFARKVANRVIFMDEGKIVEDSPKDAFFDDPKSDRAKDFLAKIL 240 ELA EGMTMM VTHEMGFA+KVA+RVIFMD+G IVED K+ FF +PKSDRAKDFLAKIL Sbjct: 181 ELAQEGMTMMCVTHEMGFAKKVAHRVIFMDKGLIVEDDRKEDFFANPKSDRAKDFLAKIL 240 Query: 241 H 241 H Sbjct: 241 H 241 Lambda K H 0.320 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 241 Length adjustment: 23 Effective length of query: 218 Effective length of database: 218 Effective search space: 47524 Effective search space used: 47524 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory