Align (S)-citramalyl-CoA lyase (EC 4.1.3.25) (characterized)
to candidate H281DRAFT_05549 H281DRAFT_05549 citrate lyase subunit beta / citryl-CoA lyase
Query= BRENDA::Q9I562 (275 letters) >FitnessBrowser__Burk376:H281DRAFT_05549 Length = 297 Score = 132 bits (332), Expect = 9e-36 Identities = 104/288 (36%), Positives = 138/288 (47%), Gaps = 28/288 (9%) Query: 4 QIVRSALFVPATRPERIPKALASGADRVIVDLEDAVEEGLKVEARANLRRFLVDTPEARV 63 Q++RS L+VPA P R+ KAL SGAD I+DLEDAV K EARANLR L Sbjct: 4 QLLRSLLYVPADNPRRVEKALNSGADAAILDLEDAVAISKKPEARANLRELLSGPRPTLA 63 Query: 64 LVRINAAEHPGHADDLALCRDHAGVIGLLLPKVESAAQV------------RHAAVASGK 111 VR+N+ DD+ AG G+ LPKVE+A + R Sbjct: 64 YVRVNSMATEFCLDDIE-AAIAAGADGISLPKVENARDLFAIDWLMSQLERRFGVDVDKV 122 Query: 112 PVWPIVESARGLAALGEIAAAAGVER-----LSFGSLDLALDLDLNSGSNAAEQILGHAR 166 + P+VES GL + + GV R L G L L L+L L+ N A R Sbjct: 123 DLLPVVES--GLGVINAPESLKGVRRVKRAGLGVGDLALELNLILSPDQNEARPY----R 176 Query: 167 YALLLQTRLAGLAPPLDGVYPAIQNRAGLVEAVRFARDMGFGGLLCIHPSQVEPIHQTLM 226 L++ + AGL PLD VY + N GL + + +GF G IHPSQVE +++ Sbjct: 177 AQLVVASNAAGLDAPLDTVYLDLNNLDGLRASCIESCRIGFQGRRIIHPSQVEIVNEVYS 236 Query: 227 PSPAELEWARRV----AEAGASGAGVFVVDGEMVDAPVLGRARRLLER 270 PSP E+ A R+ EA G V VD P+ +AR++L + Sbjct: 237 PSPEEIARAERIINEFTEAEKGGLASMRVGEVFVDYPIAEKARKILAK 284 Lambda K H 0.320 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 203 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 297 Length adjustment: 26 Effective length of query: 249 Effective length of database: 271 Effective search space: 67479 Effective search space used: 67479 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory