Align glycerone kinase (EC 2.7.1.29) (characterized)
to candidate H281DRAFT_05886 H281DRAFT_05886 dihydroxyacetone kinase DhaL subunit
Query= BRENDA::P76014 (210 letters) >FitnessBrowser__Burk376:H281DRAFT_05886 Length = 213 Score = 115 bits (287), Expect = 8e-31 Identities = 67/179 (37%), Positives = 99/179 (55%), Gaps = 1/179 (0%) Query: 23 SEYLTGLDREIGDADHGLNMNRGFSKVVEKLPAIADKDIGFILKNTGMTLLSSVGGASGP 82 ++ + LD++IGD DH N+ RG ++ IA + +G L+ +LS+VGG+SGP Sbjct: 21 TDEIASLDQQIGDGDHIFNLLRGMEALLAVRAEIAAQALGPALEIAASKVLSTVGGSSGP 80 Query: 83 LFGTFFIRAAQATQARQSLTLEELYQMFRDGADGVISRGKAEPGDKTMCDVWVPVVESLR 142 LF + A+A+ A ++ + ++F G + V RGK G KTM DV +PV + Sbjct: 81 LFFSLLNGMAKAS-ANNAMDVAGFARIFAAGVEAVGQRGKTGVGSKTMMDVLIPVAQRFE 139 Query: 143 QSSEQNLSVPVALEAASSIAESAAQSTITMQARKGRASYLGERSIGHQDPGATSVMFMM 201 Q + +N + L +AE +T M A KGRAS+LGERS GH DPGA S M+ Sbjct: 140 QLATENAAARTVLATLPRVAEENMLATRDMLATKGRASFLGERSRGHIDPGARSSQIMI 198 Lambda K H 0.316 0.130 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 86 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 210 Length of database: 213 Length adjustment: 21 Effective length of query: 189 Effective length of database: 192 Effective search space: 36288 Effective search space used: 36288 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory