Align Glycerol uptake facilitator protein 3 (characterized)
to candidate H281DRAFT_04230 H281DRAFT_04230 glycerol uptake facilitator protein
Query= SwissProt::F9UTW9 (240 letters) >FitnessBrowser__Burk376:H281DRAFT_04230 Length = 237 Score = 232 bits (591), Expect = 6e-66 Identities = 111/227 (48%), Positives = 154/227 (67%), Gaps = 1/227 (0%) Query: 11 LGEFLGTFILILLGDGVVAGVTLNKSKAQNAGWVAITLGWGFAVTMGVYASSFMSPAHLN 70 + EF+GT +++LLGDG VA V L ++K + A + I +GW AV + VY ++ S AHLN Sbjct: 5 IAEFIGTALVVLLGDGAVANVLLARTKGKGADLIVIVMGWAMAVFIAVYVTASYSGAHLN 64 Query: 71 PAVSLGMAVAGKFPWAYVIPYSAAQIAGGVIGGLVVWLHYYPHWQATKDAGAILGIFATG 130 P V++ +A+AGKF WA V Y AAQ+ GG+ G L+VW+ Y H+ DA LG+F T Sbjct: 65 PVVTISLALAGKFAWAKVPGYIAAQMLGGMAGALLVWVAYRQHFAKEGDADVKLGVFCTA 124 Query: 131 PGIRRYFWNFISEVIGTFVLVFGLLAFTKGQFTAG-LNPIVVGILIIAIGLSLGGTTGYA 189 P IR N ++E+I TFVL+ G+L Q G L+ + VG+L++ IG+SLGG TGYA Sbjct: 125 PAIRSVPHNLLTEMIATFVLILGVLYLASPQVGLGALDALPVGLLVLGIGISLGGPTGYA 184 Query: 190 INPARDLGPRIAHAVLPIANKGTSDWAYSWVPIAGPLVGGALGALLF 236 ++PARDL PR+ HA+LPI K SDW Y+W+P+ GPLVGGA+ A L+ Sbjct: 185 MSPARDLSPRLMHALLPIPGKRDSDWRYAWIPVCGPLVGGAVAAALY 231 Lambda K H 0.325 0.143 0.459 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 235 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 237 Length adjustment: 23 Effective length of query: 217 Effective length of database: 214 Effective search space: 46438 Effective search space used: 46438 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory