Align Alpha-glycerophosphate oxidase; Glycerol-3-phosphate oxidase; EC 1.1.3.21 (characterized)
to candidate H281DRAFT_04228 H281DRAFT_04228 homodimeric glycerol 3-phosphate dehydrogenase (quinone)
Query= SwissProt::O86963 (609 letters) >FitnessBrowser__Burk376:H281DRAFT_04228 Length = 509 Score = 166 bits (419), Expect = 3e-45 Identities = 161/574 (28%), Positives = 249/574 (43%), Gaps = 95/574 (16%) Query: 15 TAKTTYDVLIIGGGITGAGVAVQTAAAGMKTVLLEMQDFAEGTSSRSTKLVHGGIRYLKT 74 T T YD+L++GGGI GAG+A A G+ +L E D A TSS STKL+HGG+RYL+ Sbjct: 2 TQGTRYDLLVVGGGINGAGIARDAAGRGLSVLLCEQDDLAAHTSSASTKLIHGGLRYLEY 61 Query: 75 FDVEVVADTVRERAIVQQIAPHIPKPDPMLLPIYDEPGATFSLFSVKVAMDLYDRLAN-- 132 + +V ++ER + + APHI P ++P + + ++ + LYD LA Sbjct: 62 REFGLVRKALQERETLLRAAPHIMWPLRFVMPHMPD---LRPAWLIRAGLFLYDHLARRE 118 Query: 133 -VTGSKYENYLLTKEEVLAREPQLQAENLVGGGVYLDFRNNDARLVIENIKRAQADGAAM 191 + GS+ + + A P + E++ G VY D NDARLV+ N A GA + Sbjct: 119 LLPGSRG----IVMRDHPAGVPLV--ESIKRGFVYSDGWVNDARLVVLNALDAAEHGAKI 172 Query: 192 ISKAKVVGILHDEQGIINGVEVEDQL---TNERFEVHAKVVINTTGPWSDIVRQLDKNDE 248 +++ +++ + G E QL +V A + N GPW + Q Sbjct: 173 LTRTRLL------SAVRAGGEWRAQLRRADGTTVDVRAASIANAAGPWVGELLQGALGRA 226 Query: 249 LPPQMRPTKGVHLVVDREKLKVPQPTYFDTGKN-DGRMVFVVPRENK-TYFGTTDTDYTG 306 +R KG H+V R + + Y +N D R++F +P E+ T GTTD +Y G Sbjct: 227 ASHSVRLVKGSHIVTRR----LFEHDYAYIFQNPDKRIIFAIPYEHDYTLIGTTDLEYRG 282 Query: 307 DFAHPTVTQEDVDYLLTIVNERFPHAQITLDDIEASWAGLRPLITNNGGSDYNGGGKGKL 366 D A ++ ++ YL +N F +I+ D+ +++G+RPL+ G Sbjct: 283 DPAKVAISADETQYLCDSINRYFKQ-KISPADVRWTYSGVRPLLEEEGAD---------- 331 Query: 367 SDESFEQIVESVKEYLADERQRPVVEKAVKQAQERVEASKVDPSQVSRGSSLE----RSK 422 +PS V+R SLE + Sbjct: 332 -----------------------------------------NPSAVTRDYSLELDAPAGE 350 Query: 423 DGLLTLAGGKITDYRLMAEGAVKRINELLQESGASFELVDSTTYPVSGGELDAANVEEEL 482 LL++ GGKIT +R +AE AV ++ L S+ + P+ GG++ AN E L Sbjct: 351 APLLSVFGGKITTFRKLAEEAVDKLAPALGSDAPSW----TAGAPLPGGDIPQANFERFL 406 Query: 483 AKLADQAQTAGFNEAAATYLAHLYGSNLPQVLNYKTKFEGLDEK-----ESTALNYSLHE 537 A L + Q A A LA YG+ + V+ GL + L Y Sbjct: 407 AGL--KQQHAWLPADLAHRLARAYGTRVKNVIGDARSLAGLGQAFAPGLYEAELTYLRDT 464 Query: 538 EMVLTPVDYLLRRTNHILFMR-DTLDDVKAGVVA 570 E + D L RR+ L + TLD + + A Sbjct: 465 EWARSAHDVLWRRSKLGLHVEPGTLDSITRDIDA 498 Lambda K H 0.314 0.132 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 556 Number of extensions: 36 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 609 Length of database: 509 Length adjustment: 36 Effective length of query: 573 Effective length of database: 473 Effective search space: 271029 Effective search space used: 271029 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory