Align ABC transporter for Glycerol, permease component 1 (characterized)
to candidate H281DRAFT_03732 H281DRAFT_03732 carbohydrate ABC transporter membrane protein 1, CUT1 family
Query= reanno::acidovorax_3H11:Ac3H11_793 (298 letters) >FitnessBrowser__Burk376:H281DRAFT_03732 Length = 298 Score = 461 bits (1187), Expect = e-135 Identities = 223/293 (76%), Positives = 251/293 (85%) Query: 6 KPVNQKAWFLILPVIICVAFSAILPLMTVVNYSVQDIISPERRVFVGTEWFAAVMRDEEL 65 KPVNQKAW L++PV ICVAFSAILPLMTVVNYSVQDIISP + VFVGTEWF +M D +L Sbjct: 3 KPVNQKAWLLVVPVFICVAFSAILPLMTVVNYSVQDIISPTQHVFVGTEWFRNIMTDPDL 62 Query: 66 HAALWRQLTFSLAVLAVEIPLGILLALSMPAQGWKSSAVLVVVALSLLIPWNVVGTIWQI 125 AL RQ+ FS VL EIPLG+ LAL+MPA GW++SA LV++A+ LLIPWNVVGTIWQI Sbjct: 63 RDALGRQIIFSACVLLFEIPLGVGLALAMPASGWRASAALVILAMPLLIPWNVVGTIWQI 122 Query: 126 YGRADIGLMGRMLQEMGIEYSYTGNATQAWLTVLLMDVWHWTPLVALLAFAGLRSIPDAY 185 +GR DIGL+G L +G +Y+YT + T AWLTVL+MD+WHWTPLVALL +AGLR+IPDA+ Sbjct: 123 FGRPDIGLLGYWLNSLGFDYNYTASPTAAWLTVLVMDIWHWTPLVALLCYAGLRAIPDAF 182 Query: 186 YQAARIDGASKFAVFRYIQLPKMRGVLMIAVLLRFMDSFMIYTEPFVLTGGGPGNATTFL 245 YQAA IDGAS+FAVFRYI+LPKMRGVLMIAVLLRFMDSFMIYTEPFVLTGGGPG++TTFL Sbjct: 183 YQAAEIDGASRFAVFRYIELPKMRGVLMIAVLLRFMDSFMIYTEPFVLTGGGPGDSTTFL 242 Query: 246 SQYLTTKAVGQFDLGPAAAFSLIYFFIILLLCFILYNWMQRVGTVSDEGAGHE 298 SQYLT KAVGQFDLGPAAAFSLIYF IILLLCFILYNWM RVG G E Sbjct: 243 SQYLTQKAVGQFDLGPAAAFSLIYFLIILLLCFILYNWMSRVGKGGPAAEGDE 295 Lambda K H 0.328 0.140 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 344 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 298 Length adjustment: 27 Effective length of query: 271 Effective length of database: 271 Effective search space: 73441 Effective search space used: 73441 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory