Align GlpP, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate H281DRAFT_05891 H281DRAFT_05891 carbohydrate ABC transporter membrane protein 1, CUT1 family
Query= TCDB::G3LHZ0 (288 letters) >FitnessBrowser__Burk376:H281DRAFT_05891 Length = 318 Score = 132 bits (332), Expect = 1e-35 Identities = 83/272 (30%), Positives = 139/272 (51%), Gaps = 13/272 (4%) Query: 9 AWFLVLPVLLLVAFSAVIPLMTVVNYSVQDTFGNNEFF---WAGTDWFVQTLHSDRFWES 65 AW +LP +LL+ + PL+ + S + N + G D +V L + W + Sbjct: 33 AWLFILPTILLLLAINIFPLIWALRLSFTNFKSNMPSVPARFVGIDNYVDILTDEDIWYA 92 Query: 66 LQRNLLFSFIILALEIPLGIFIALNMPKSGPGVPVCLVLMALPLLIPWNVVGTIWQVFGR 125 +Q F F + LE+ LG +AL + + G L+ LP+++ VVG W + Sbjct: 93 MQVTARFVFWSVGLEVLLGFGLALLINRQFRGHSFWTTLILLPMMLSPAVVGNFWTFLLQ 152 Query: 126 VDIGLLGHTLEAIGL-------DYNYVRDPIDAWVTVIVMDVWHWTSLVVLLCYAGLVSI 178 GL + +G + + D A T++++D W WT V+L+C AGL SI Sbjct: 153 PQTGLFN---DIVGFFTGIAPGSFQMIGDVSLAPWTIVMVDTWMWTPYVMLICLAGLRSI 209 Query: 179 PDAYYQAAKIDGASRWSVFRYIQLPKMKRVLLIAVLLRFMDSFMIYTEPFVVTGGGPGNS 238 PD Y+AA++D A+ W F I LP L++AVL R +++F ++ ++T GGPG+ Sbjct: 210 PDYIYEAAEVDRATPWRQFWSITLPMTLPFLMLAVLFRGIENFKMFDMVNLLTSGGPGSV 269 Query: 239 TTFLSIDLVKMAVGQFDLGPAAAMSIIYFLII 270 T +SI L + A ++ G ++A++II F+ + Sbjct: 270 TETVSITLKRAAFEKWQTGYSSALAIILFVTV 301 Lambda K H 0.329 0.143 0.464 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 278 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 318 Length adjustment: 27 Effective length of query: 261 Effective length of database: 291 Effective search space: 75951 Effective search space used: 75951 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory