Align GlpQ, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate H281DRAFT_05890 H281DRAFT_05890 carbohydrate ABC transporter membrane protein 2, CUT1 family
Query= TCDB::G3LHZ1 (273 letters) >FitnessBrowser__Burk376:H281DRAFT_05890 Length = 317 Score = 152 bits (385), Expect = 7e-42 Identities = 83/288 (28%), Positives = 139/288 (48%), Gaps = 33/288 (11%) Query: 19 YIIFLILPIYWLINMSFKENSEITGAFSLWPTNPTLRNYTVIFTDPS------------- 65 Y + ILPI W+ SFK + + P++ Y +FT S Sbjct: 28 YALIAILPILWICLTSFKTQEDAIAYPPVVLFQPSMEGYVNLFTIRSRQTPEFIASLPPA 87 Query: 66 --WYNG------------------YINSIIYVVMNTVISVAAALPAAYAFSRYRFLGDKH 105 WY ++NS++ +T ++V AAYAFSR++ Sbjct: 88 QTWYERDVRKRNMVIAGPSKVLPRFVNSLVIGFGSTFLAVFLGTLAAYAFSRFKVPLADD 147 Query: 106 LFFWLLTNRMAPPAVFALPFFQLYSAFGLIDTHIAVALAHCLFNVPLAVWILEGFMSGVP 165 L F++L+ RM PP A+P + +Y A GL D+++ + + + NV LAVW+L+GFM +P Sbjct: 148 LLFFILSTRMMPPIAVAIPIYLMYRALGLSDSYVGMIVLYTAVNVSLAVWLLKGFMDEIP 207 Query: 166 KEIDETAYIDGYSFPRFFIKIFIPLIASGVGVAGFFCFMFSWVELLLARTLTTTAAKPIS 225 +E +E A +DGY+ + F+K+ +P +G+ FC +F+W E A LT+ A+ + Sbjct: 208 REYEEAALVDGYTRLQAFVKVVLPQAITGIAATAIFCLIFAWNEYAFASLLTSGDAQTMP 267 Query: 226 AIMTRTVSASGMDWGVLAAAGVLTIIPGALVIYFVRNYIAKGFALGRV 273 + + G DW +AAA L ++P + +R ++ +G G V Sbjct: 268 PFIPFIIGEGGQDWPAVAAATTLFVVPILIFTVVLRKHLLRGITFGAV 315 Lambda K H 0.330 0.142 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 317 Length adjustment: 26 Effective length of query: 247 Effective length of database: 291 Effective search space: 71877 Effective search space used: 71877 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory