Align ABC transporter for Glycerol, ATPase component 2 (characterized)
to candidate H281DRAFT_03733 H281DRAFT_03733 carbohydrate ABC transporter ATP-binding protein, CUT1 family
Query= reanno::acidovorax_3H11:Ac3H11_792 (358 letters) >FitnessBrowser__Burk376:H281DRAFT_03733 Length = 374 Score = 420 bits (1079), Expect = e-122 Identities = 215/364 (59%), Positives = 265/364 (72%), Gaps = 11/364 (3%) Query: 1 MARISL-DLAHSYKPNPQQDSDYALLPLKMEFEDGGAYALLGPSGCGKTTMLNIMSGLLV 59 MARI +LAH+Y+PNP DYAL P+ M +EDGGAYALLGPSGCGKTT+LNI+SGL+ Sbjct: 1 MARIEFQNLAHAYRPNPATLDDYALQPMSMVWEDGGAYALLGPSGCGKTTLLNIVSGLVK 60 Query: 60 PSHGKVLFDGRDVTRASPQERNIAQVFQFPVIYDTMTVAENLAFPLRNRKVPEGQIKQRV 119 PS GKVLFDGRDVT +ERNIAQVFQFPVIYDTM+V +NLAFPLRNRK+P +++ RV Sbjct: 61 PSEGKVLFDGRDVTALGARERNIAQVFQFPVIYDTMSVFDNLAFPLRNRKIPAAEVRNRV 120 Query: 120 GVIAEMLEMSGQLNQRAAGLAADAKQKISLGRGLVRADVAAVLFDEPLTVIDPHLKWQLR 179 +A++L+M+ L +A+ LAADAKQKISLGRGLVR DVAA+LFDEPLTVIDP +KW LR Sbjct: 121 HEVADILDMTRDLPHKASNLAADAKQKISLGRGLVRQDVAAILFDEPLTVIDPAMKWMLR 180 Query: 180 RKLKQIHHELKLTLIYVTHDQVEALTFADQVVVMTRGKAVQVGSADALFERPAHTFVGHF 239 R+LK+IH +LKLTLIYVTHDQVEALTFAD+VVVMT G+ VQ G ADALF RP H FVG+F Sbjct: 181 RQLKKIHQQLKLTLIYVTHDQVEALTFADEVVVMTNGRVVQKGGADALFLRPDHAFVGYF 240 Query: 240 IGSPGMNFLPAHRDGENLSVAGHRLASPVGRALPA--------GALQVGIRPEYLALAQP 291 IGSPGMN P D E + RLA G+L +GIRPE++ LAQ Sbjct: 241 IGSPGMNLCPIELDAEGARIGAQRLALDTDTLATLRHAHEHANGSLTLGIRPEFVRLAQE 300 Query: 292 QQAGALPGTVVQVQDIGTYQMLTAKVGEHTVKARFTPETRLPSSGDTAWLQVLGEHTCYY 351 +AGA+ V++ Q +G YQ++TA+ H A+ P R+ AWL++ T ++ Sbjct: 301 GEAGAVKAQVLRAQQLGNYQLVTAQCDGHLFNAKLEPHVRVVDG--PAWLRLAAPETVFF 358 Query: 352 KNEE 355 N+E Sbjct: 359 CNDE 362 Lambda K H 0.320 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 392 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 374 Length adjustment: 30 Effective length of query: 328 Effective length of database: 344 Effective search space: 112832 Effective search space used: 112832 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory