Align ABC transporter for Glycerol, ATPase component 2 (characterized)
to candidate H281DRAFT_05888 H281DRAFT_05888 carbohydrate ABC transporter ATP-binding protein, CUT1 family
Query= reanno::acidovorax_3H11:Ac3H11_792 (358 letters) >FitnessBrowser__Burk376:H281DRAFT_05888 Length = 367 Score = 213 bits (543), Expect = 5e-60 Identities = 128/322 (39%), Positives = 188/322 (58%), Gaps = 10/322 (3%) Query: 34 GGAYALLGPSGCGKTTMLNIMSGLLVPSHGKVLFDGRDVTRASPQERNIAQVFQFPVIYD 93 G LLGPSGCGKTT L +++GL +P+ G++L DG DVT+ ++R+IA VFQ +Y Sbjct: 29 GRFVVLLGPSGCGKTTTLRMIAGLELPTSGQILIDGDDVTQLRARQRDIAFVFQMFALYP 88 Query: 94 TMTVAENLAFPLRNRKVPEGQIKQRVGVIAEMLEMSGQLNQRAAGLAADAKQKISLGRGL 153 MTV N+AFPLRN V +I RV A ML + L+++ GL+ +Q+++LGR + Sbjct: 89 HMTVRNNIAFPLRNEHVSRKEIAARVDAAAHMLRIENILDRKTGGLSGGDRQRVALGRAI 148 Query: 154 VRADVAAVLFDEPLTVIDPHLKWQLRRKLKQIHHELKLTLIYVTHDQVEALTFADQVVVM 213 VR A L DEPL +D + + +L+++H+ L T +YVTHDQ EA+ AD +VVM Sbjct: 149 VR-QPKAFLMDEPLGTLDADFRELMCLELRKLHNALGATTVYVTHDQSEAMAMADDIVVM 207 Query: 214 TRGKAVQVGSADALFERPAHTFVGHFIGSPGMNFLPAHR--DGENLSVAGHRLASPVGRA 271 +G+ +Q G ++ PA FVG+FIGSP MNFL A + + V H A PV R+ Sbjct: 208 NKGELLQAGPPHEIYHFPATVFVGNFIGSPPMNFLAADGGVNAGDEQVLLHGAAVPVPRS 267 Query: 272 LPAGALQV--GIRPEYLALAQPQQAGALPGTVVQVQDIGTYQMLTAKVGEHTVKARFTPE 329 AGA +V GIRPE++ + + G L G V+ + +G++Q+L + V+ R + Sbjct: 268 -EAGAERVLLGIRPEHVTI---DEHGPLRGKVIADEYLGSHQVLVVETALGVVRVRVGKD 323 Query: 330 TRLPSSGDTAWLQVLGEHTCYY 351 LP +G L + T Y Sbjct: 324 DGLP-AGSPVGLSFRKDRTLLY 344 Lambda K H 0.320 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 355 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 367 Length adjustment: 29 Effective length of query: 329 Effective length of database: 338 Effective search space: 111202 Effective search space used: 111202 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory