Align ABC transporter for L-Histidine, periplasmic substrate-binding component 1 (characterized)
to candidate H281DRAFT_03350 H281DRAFT_03350 amino acid ABC transporter substrate-binding protein, PAAT family
Query= reanno::acidovorax_3H11:Ac3H11_2555 (249 letters) >FitnessBrowser__Burk376:H281DRAFT_03350 Length = 251 Score = 321 bits (823), Expect = 8e-93 Identities = 167/254 (65%), Positives = 200/254 (78%), Gaps = 11/254 (4%) Query: 1 MNLRRNLLLASLAAAAFCTT------GAQAQD-NVLRVGTDATFPPMEFVENGKRTGFDI 53 M L+R L SLA +F T A AQ +VL V TDATFPPME+ ENG RTGFD+ Sbjct: 1 MKLQR---LLSLACISFAVTFGGFPGAASAQTPDVLNVATDATFPPMEYTENGARTGFDV 57 Query: 54 ELVEAIAKTMGKQVEWVDIDFKGLIPGLISKRFDMAVSAIYITDERKKVVDFTDSYYAGG 113 +L+ A+AK MGK+V+W DIDFKGLIPGLI+ RFD A+S IYITDER KVVDFTDSYYAGG Sbjct: 58 DLMNALAKAMGKRVQWTDIDFKGLIPGLIAHRFDAAISGIYITDERAKVVDFTDSYYAGG 117 Query: 114 LVVMVKADNKAINKLADLDGKKVSVQVGTKSVSYLTEKFPKVQRVEVEKNQEMFNLVDIG 173 L V+VK+D+ + + DL+GKKVSVQVGTKSV++L + FP++ RVEVEKNQEMF+LV IG Sbjct: 118 LAVLVKSDSP-VKTVTDLNGKKVSVQVGTKSVNFLRDNFPQINRVEVEKNQEMFDLVGIG 176 Query: 174 RADAAVTGKPAAFQYVRTRPGLRVLDEQLTTEEYGMALRKDTPELTKAVNGAITKLKADG 233 RADAAVTGKPAA+Q +TR G RVLD+ LTTE YG+A+RKD P+L +N A+ K+KADG Sbjct: 177 RADAAVTGKPAAYQVAKTRAGFRVLDKTLTTEAYGIAVRKDEPQLKADLNTALAKIKADG 236 Query: 234 TYAAIVKKWFSNSA 247 TYAAIVKKWF SA Sbjct: 237 TYAAIVKKWFGASA 250 Lambda K H 0.317 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 249 Length of database: 251 Length adjustment: 24 Effective length of query: 225 Effective length of database: 227 Effective search space: 51075 Effective search space used: 51075 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory