Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate H281DRAFT_00233 H281DRAFT_00233 NitT/TauT family transport system ATP-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_2560 (259 letters) >FitnessBrowser__Burk376:H281DRAFT_00233 Length = 448 Score = 202 bits (513), Expect = 1e-56 Identities = 112/253 (44%), Positives = 155/253 (61%), Gaps = 11/253 (4%) Query: 6 IQAVSRVFETAKGQRTQALQPVDFEVRDNDFVTILGPSGCGKSTLLRIVAGLDHATSGRV 65 ++ V R F ++G+ L + +R+ + V +LG SG GKSTLLRI+AGL T G V Sbjct: 29 VKDVCRGFNKSQGELL-VLDDANLSLREGEIVGLLGRSGSGKSTLLRIIAGLIEPTDGEV 87 Query: 66 LLDGAPVEGPGAERGMVFQSYTLFPWLTIEQNIRFGLRERGMPEAQQKERAAYFIAKVGL 125 G P++GP MVFQ++ LFPWLT+ QN+ GL +G+ +++ERA I +GL Sbjct: 88 TYMGKPLDGPAKGVAMVFQTFALFPWLTVLQNVEAGLEAQGVAARERRERALAAIDLIGL 147 Query: 126 RGFEQHFPKQLSGGMQQRTAIARALANDPKILLMDEPFGALDNQTRVLMQELLLGIWEAE 185 GFE +P++LSGGM+QR ARAL DP +LLMDEPF ALD T ++ LL +W Sbjct: 148 DGFENAYPRELSGGMRQRVGFARALVVDPTLLLMDEPFSALDVLTAETLRTDLLDLWTQG 207 Query: 186 R---KTVLFVTHDIDEAIFMANRVAVFSARPGRIKTELAVDLPHPRHYTIKTSPEFMDLK 242 R K VL VTH+I+EA+FM +R+ V S+ PGR+ E+ V HPR+ + P F Sbjct: 208 RMPIKAVLIVTHNIEEAVFMCDRILVLSSNPGRVIAEIKVPFKHPRN---RLDPAF---- 260 Query: 243 ARLTEEIRAESMA 255 RL +EI A+ A Sbjct: 261 RRLVDEIYAKMTA 273 Lambda K H 0.322 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 448 Length adjustment: 28 Effective length of query: 231 Effective length of database: 420 Effective search space: 97020 Effective search space used: 97020 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory