Align Extracellular solute-binding protein family 3; Flags: Precursor (characterized, see rationale)
to candidate H281DRAFT_00224 H281DRAFT_00224 amino acid ABC transporter substrate-binding protein, PAAT family
Query= uniprot:B2TBJ6 (286 letters) >FitnessBrowser__Burk376:H281DRAFT_00224 Length = 258 Score = 134 bits (338), Expect = 2e-36 Identities = 85/276 (30%), Positives = 138/276 (50%), Gaps = 28/276 (10%) Query: 15 AVLGAAAIFAAPAQAKDWKTVTIALEGGYAPWNLTLPGGKLGGFEPELVANLCERIKLQC 74 A+ A A+ A A AK+WKTV I ++ Y P+ G++ GF+ +L LC R+ ++C Sbjct: 5 ALCVALAVMATGAMAKEWKTVRIGVDASYPPFESKAASGQVVGFDVDLTKALCARMNVKC 64 Query: 75 NLVAQDWDGMIPGLQAGKFDVLMDAISITPEREKIIAFS-KPYAATPATFAVADAKVLPK 133 V QD+DG+IP L+ KFD ++ ++++T +R + I FS K + A A A + +LP Sbjct: 65 VWVEQDFDGIIPALKGKKFDAIVSSLTVTDKRREQIDFSDKLFDAPARMIAKAGSPLLPT 124 Query: 134 AAPGAGVVKLSGDPKADQPTVDALRKQLKGKTIGIQSGTVYTKFINDGFKDI-ATIRVYK 192 A + LKGK IG++ GT + ++ T+ Y+ Sbjct: 125 A------------------------ESLKGKRIGVEQGTTQEAYAKAYWEPKGVTVVPYQ 160 Query: 193 TSPERDLDLANGRIDASF-DDVTYYAANIDKKETASIVMAGPKIGGP-IWGPGEGLAFRK 250 + DL +GR+DA+ D++ A + AGP++ P G G + RK Sbjct: 161 NQDQVYADLTSGRLDAALQDEIQADAGFLKTPRGKGFAWAGPEVKDPKTIGEGTAIGLRK 220 Query: 251 QDADLKAKFDTAISAALADGTVKKLSNKWFKTDVTP 286 +DADL+ F+ A++ DGT KL ++F D+ P Sbjct: 221 EDADLRTMFNRALAQVHQDGTFTKLEKQYFDFDIYP 256 Lambda K H 0.316 0.134 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 286 Length of database: 258 Length adjustment: 25 Effective length of query: 261 Effective length of database: 233 Effective search space: 60813 Effective search space used: 60813 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory