Align ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, permease component 1 (characterized)
to candidate H281DRAFT_05872 H281DRAFT_05872 amino acid ABC transporter membrane protein 2, PAAT family
Query= reanno::Smeli:SMc02119 (397 letters) >FitnessBrowser__Burk376:H281DRAFT_05872 Length = 214 Score = 89.7 bits (221), Expect = 7e-23 Identities = 55/161 (34%), Positives = 86/161 (53%), Gaps = 7/161 (4%) Query: 234 LVTFLVTGAPITFDIPVAGKFNLTGGSVVG---PEFMSLFLALSFYTAAFIAEIVRAGIR 290 L T L G P+ + F G S G F + + LS Y A+IAE+ RAGI Sbjct: 55 LYTELFRGTPVLITL----MFIYFGVSYFGYAIDVFAAGVIGLSVYQGAYIAEVFRAGIE 110 Query: 291 GVSKGQTEAAHALGIRPALTTRLVVVPQAMRIIIPPLTSQYLNLTKNSSLAVAIGYADLV 350 V KGQ E + LG+ T VV+PQ RI++PPL QYL+L K++S+ IG ++L+ Sbjct: 111 SVPKGQWEVSQILGLSRIQTFASVVLPQTGRIVLPPLVGQYLSLIKDTSIVSMIGMSELM 170 Query: 351 AVGGTILNQTGQSIEIVSIWLIVYLSLSLATSLFMNWYNAR 391 G I+++ G+ +EI + ++Y + S ++ ++ R Sbjct: 171 HGGQAIVDRVGKPVEIYGLVALIYFVVCFPLSQWVRHHDRR 211 Score = 48.9 bits (115), Expect = 1e-10 Identities = 23/64 (35%), Positives = 37/64 (57%) Query: 89 LLVGFINTLLVAITGIITATIIGFIVGIGRLSHNWIIAKLSLAYVEVFRNIPPLLVIFFW 148 LL G + TLL++I I+ +T+IG + + R W +++ Y E+FR P L+ + F Sbjct: 13 LLQGLVTTLLLSIAAIVGSTLIGLLAAVLRSFGPWGTDRIAKLYTELFRGTPVLITLMFI 72 Query: 149 YSGV 152 Y GV Sbjct: 73 YFGV 76 Lambda K H 0.327 0.141 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 397 Length of database: 214 Length adjustment: 26 Effective length of query: 371 Effective length of database: 188 Effective search space: 69748 Effective search space used: 69748 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory