Align BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)
to candidate H281DRAFT_03348 H281DRAFT_03348 amino acid ABC transporter ATP-binding protein, PAAT family
Query= TCDB::P73721 (252 letters) >FitnessBrowser__Burk376:H281DRAFT_03348 Length = 258 Score = 257 bits (656), Expect = 2e-73 Identities = 135/247 (54%), Positives = 169/247 (68%), Gaps = 2/247 (0%) Query: 7 PLISFDQLQKNFGALQVLRGVTGEIYPKDVISIIGPSGCGKSTFLRCLNRLEPISGGRLE 66 P++S L K+FG+ VL G+ +I+P+ V+ +IGPSG GKSTFLRC N LE G ++ Sbjct: 10 PIVSIRGLTKSFGSHTVLNGIDFDIHPQQVVVVIGPSGSGKSTFLRCCNGLEQAERGTID 69 Query: 67 VAGVDL--SGAKIDQKHLRQLRVRVGMVFQHFNLFPHLTVLQNLLLAPRKVLRIPMAEAK 124 + G L GA + ++ L LR VGMVFQ FNLFPHL+VL N+ + PR + A+A+ Sbjct: 70 ICGHRLVDQGAMLKERSLNALRTEVGMVFQSFNLFPHLSVLHNITVGPRMLRGASKAQAE 129 Query: 125 DRALTYLDKVGLGTKADNYPDQLSGGQKQRVAIARGLCMKPEILLFDEPTSALDPELVGE 184 A+ L+KVGL KAD P LSGGQKQRVAIAR L M+P ++LFDEPTSALDPELVGE Sbjct: 130 AAAIALLEKVGLAHKADVMPASLSGGQKQRVAIARALAMQPRVMLFDEPTSALDPELVGE 189 Query: 185 VLNVMKQLAEEGMTMAVVTHEMQFAREVSNRVFFFNQGIIEEEGDPNEVFRNPKSDRLRA 244 VL VMK LA EGMTM VVTHEM FA+EV++ V + G+I E G P E+F P R RA Sbjct: 190 VLQVMKLLASEGMTMVVVTHEMGFAKEVADVVVVMDGGVIVEAGPPAEIFSAPSQPRTRA 249 Query: 245 FLSRIQS 251 FL + S Sbjct: 250 FLQAVLS 256 Lambda K H 0.321 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 258 Length adjustment: 24 Effective length of query: 228 Effective length of database: 234 Effective search space: 53352 Effective search space used: 53352 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory