Align BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)
to candidate H281DRAFT_05293 H281DRAFT_05293 amino acid ABC transporter ATP-binding protein, PAAT family
Query= TCDB::P73721 (252 letters) >FitnessBrowser__Burk376:H281DRAFT_05293 Length = 263 Score = 248 bits (632), Expect = 1e-70 Identities = 135/255 (52%), Positives = 177/255 (69%), Gaps = 9/255 (3%) Query: 5 TAPL-ISFDQLQKNFGALQVLRGVTGEIYPKDVISIIGPSGCGKSTFLRCLNRLEPISGG 63 TAP+ +S + K+FG VL+G++ + + DVISI+G SG GKSTFLRCLN LE G Sbjct: 4 TAPVALSVKNIHKSFGDHHVLKGISLDAHQGDVISILGASGSGKSTFLRCLNLLETPDDG 63 Query: 64 RLEVAGVDLSGAK--------IDQKHLRQLRVRVGMVFQHFNLFPHLTVLQNLLLAPRKV 115 + +AG +L + D++ + ++R ++GMVFQ+FNL+ H+TVL+NL+ P +V Sbjct: 64 SVALAGEELKMKRRGDGKLQPSDRRQVDRVRSQLGMVFQNFNLWSHMTVLENLIEGPMRV 123 Query: 116 LRIPMAEAKDRALTYLDKVGLGTKADNYPDQLSGGQKQRVAIARGLCMKPEILLFDEPTS 175 + AE+ + A L KVGL K +YP LSGGQ+QRVAIAR L M P+++LFDEPTS Sbjct: 124 QKRSRAESVEEAEALLAKVGLAEKRGHYPAHLSGGQQQRVAIARALAMHPKVMLFDEPTS 183 Query: 176 ALDPELVGEVLNVMKQLAEEGMTMAVVTHEMQFAREVSNRVFFFNQGIIEEEGDPNEVFR 235 ALDPELVGEVL VM+ LAEEG TM VVTHEM FAR VSNRV F +QG +E +G P+EVF Sbjct: 184 ALDPELVGEVLRVMRSLAEEGRTMLVVTHEMGFARHVSNRVMFLHQGQVEADGTPDEVFV 243 Query: 236 NPKSDRLRAFLSRIQ 250 KS+R R F+S Q Sbjct: 244 ECKSERFRQFVSSHQ 258 Lambda K H 0.321 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 263 Length adjustment: 24 Effective length of query: 228 Effective length of database: 239 Effective search space: 54492 Effective search space used: 54492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory